KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109438617Help
Entry
109438617         CDS       T04863                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    109438617 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109438617 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    109438617 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    109438617 (MGLL)
Enzymes [BR:rss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109438617 (MGLL)
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S33
   109438617 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 346 aa AA seqDB search
MPRCDRGDEGTALNCLALILKAVVVVECKSHDKMETGLGDPFKMPEESSPRRTPQSVRYQ
DLPHLVNADGQYLFCRYWKPEGTPKALVFVSHGAGEHCGRYDELAQMLVGLELLVFAHDH
VGHGQSEGERMVVSDFHVFIRDVLQHVDTMQKDYPELPVFLLGHSMGGAITILTAAEKPG
YFSGMILISPLVLANPESATTFKVLAAKVLNLVLPNMSLGPIDASVLSRNKTEVDLYNTD
PLICRAGLKVCFGIQLLNAVSRVERALSKLTVPFLLLQGSADRLCDSKGAYLLMESAKSQ
DKTLKIYEGAYHVLHKELPEVTNSVFHEINMWISQRTAAARTGSPP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctgtgaccgcggcgatgagggaacagcccttaattgcctggctctgattctc
aaggctgtcgtggttgtggaatgcaaaagccacgacaagatggaaacaggacttggagat
cctttcaaaatgccggaggaaagttctcccaggcggacaccgcagagcgttcggtaccag
gacctccctcatttggtcaatgctgatggacagtacctcttctgtaggtactggaaaccc
gagggcactcccaaggcccttgtctttgtgtcccatggagctggagagcactgcggtcgc
tatgatgagctagctcagatgctggtggggctagaactgctggtgtttgctcacgaccat
gttggccatggacagagcgaaggggagaggatggtagtgtccgacttccatgttttcatc
agggatgtgttacaacacgtggataccatgcagaaagactacccagagcttcctgtcttc
cttctgggccactccatgggaggtgccatcaccatcctcacagccgcagagaagccaggt
tacttttccggcatgattctcatttcacctttggttctggccaatcctgagtccgcaaca
actttcaaggtccttgctgcgaaagttctcaaccttgtcctgccaaacatgtccctgggc
ccaattgatgccagcgtgctctctcggaataagacggaggtggacctttacaacacagac
cccctcatctgccgggcaggactgaaagtgtgctttggcatccagctgctcaatgccgtc
tcgcgggtggagcgggccctctccaagctgactgtgcccttcctgctgctccagggctct
gctgaccgcctgtgcgacagcaaaggggcctatttgctcatggagtctgccaagagtcag
gacaagacactcaagatttatgaaggtgcctaccacgttctccacaaagagcttcctgaa
gtaaccaactctgtcttccatgaaataaacatgtggatctctcaaaggacagcggcagcg
agaacagggtccccaccctga

DBGET integrated database retrieval system