KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109439076Help
Entry
109439076         CDS       T04863                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Brite
Enzymes [BR:rss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109439076 (ABHD12)
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109439076 (ABHD12)
Exosome [BR:rss04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109439076 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 393 aa AA seqDB search
MRKRTEPVALEHECCVVSGSSSSVLDADCRLKRNLCLAGKGSAEPRSAADAGMKRALGRR
KGLWFRLRKILLCVLGLYIIIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHT
CNYYLQPEEDVTIGVWHTVPAVWWKTAQGKDQIWYEDALASSYPIILYLHGNAGTRGGDH
RVELYKVLSSLGYHVVTFDYRGWGDSVGTPSEQGMTYDALHVFDWIKARSGDNPVYIWGH
SLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDPI
TSSGIKFANDENVKHISCSLLILHAEDDPVVPFQLGRKLYNIAAPSRSFQDFKVQFIPFH
SDLGYRHKYIYKSPELPRILREFLGKSEPEHQH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcgccttggagcatgagtgctgcgtcgtctcgggctcg
tcctcctcagtgctggacgccgactgccgcttgaagcggaacctgtgcctggcgggcaag
gggtcggccgagccgcgctccgccgctgacgcgggcatgaagcgggcgctaggcaggcga
aagggcctgtggttccgactgaggaaaatacttctctgtgttttggggttgtatattatc
attccatttctcatcaaactatgtcctgggatacaggccaaactgattttcttgaatttt
gtgagggttccctatttcattgacttgaaaaaaccacaggatcaaggtttgaatcacacc
tgtaattactacctccagccagaagaagacgtgaccattggagtctggcacactgtccct
gctgtctggtggaagactgcccaagggaaggaccagatatggtacgaggatgccttggct
tccagttaccctatcattctgtacctgcatggtaatgcaggcaccagaggtggtgaccac
cgagtggagctttacaaggtgctgagttcacttggttaccatgtggttacctttgactac
agaggttggggtgactcagtaggcacaccatcggaacagggcatgacctatgatgcactc
catgtttttgactggatcaaagcaagaagtggggacaaccctgtgtatatttggggccac
tccctaggcactggagtggcaacaaatctggtacggcgcctctgtgagcgagagacacct
ccagatgcccttatattggaatctccattcactaatatccgagaagaagctaagagccat
ccattctcagtgatatatcgatacttccctgggtttgactggttcttcctcgatcccatt
acaagcagtggaattaaatttgcaaatgatgaaaacgtgaagcacatctcctgctccctg
ctcatcctgcatgccgaggacgaccccgttgtgcccttccagcttggcagaaagctctac
aacatcgctgcaccatctcgaagcttccaagatttcaaagttcagtttatcccctttcac
tcagaccttggctacaggcacaagtacatctacaagagccccgagcttcctcggatactg
agggaattcctggggaagtcggaacccgagcaccagcactga

DBGET integrated database retrieval system