KEGG   Rickettsia slovaca 13-B: Rsl_1200Help
Entry
Rsl_1200          CDS       T01671                                 

Gene name
mutM
Definition
Formamidopyrimidine-DNA glycosidase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rsv  Rickettsia slovaca 13-B
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rsv03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
973424..974245
Genome map
AA seq 273 aa AA seqDB search
MPELPEVETLKNSLKDKLIGLIIENVELKRDNLRYKLSPLLATEILNTNILDVRRRAKYL
IIDFNNDYSLIVHLGMSGRFTLQSANYKTQKHDHVIFDLSNGEKLIFNDTRRFGMIYSFK
TDLLEKEFFNDLGIEPFSDLLTLEYLKDKLQTKKIPIKNLIMDNRVIVGVGNIYASESLH
LARIHPDKSGNDLRDDEIENLIKAIRDVLTKAITAGGTTLKDFVNGDNKPGYFTKQLKVY
GREGQSCLSCSSTIIKIKHSGRSTFYCKTCQYS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacttcctgaagtagaaactcttaaaaactctctaaaagataagctaatcggg
cttattatagaaaatgtagagttaaaaagagataatttacgttataagctatccccgctt
ttagctacagaaatcttaaatactaatatactggatgttaggcgtcgtgcaaaatattta
attatagattttaataatgattattctttaatagttcatctaggcatgagcggcagattt
actctgcaatctgctaattataaaactcaaaaacacgatcatgtgatttttgatttaagt
aacggcgaaaagttaattttcaacgatactagacgattcggtatgatttatagttttaag
actgatctcttagaaaaagaattttttaatgatttaggcatagagcctttttctgattta
ttgacgttagaatatctgaaagataagctacaaactaaaaaaataccaataaaaaacttg
attatggataatagagttatagtcggagtcggtaatatctatgcttccgaaagtctgcat
ttagctagaattcatccggataaatcaggtaacgatttaagggatgatgaaatagaaaat
ttaattaaagcgattagagatgtgttaactaaagctataactgccggcggtactactctt
aaagattttgtaaacggcgataacaaacctggttattttactaagcaacttaaggtttac
ggtagagagggacaaagttgtttaagctgctctagcactattatcaagataaagcattca
ggcagaagtactttttattgtaaaacttgccaatatagttaa

DBGET integrated database retrieval system