KEGG   Rickettsia slovaca 13-B: Rsl_1364Help
Entry
Rsl_1364          CDS       T01671                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rsv  Rickettsia slovaca 13-B
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rsv00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1099539..1100165)
Genome map
AA seq 208 aa AA seqDB search
MERSTAATSKLPLEVELSRNSKGLIIILSSPSGTGKSSLAKALLKIDNNLRLSISATTRK
PRLGEVEGINYYFKTGLEFEELVKQNKFLEYAKIYDDYYGTPKEYVEMLLNQGLDVLFDI
DWQGARSIKKNATNVVAIFVLPPNIEVLEQRLRNRATDNEEAIKLRMQSAQNEISHANEY
DYVVTNDDFDRTLKKIHAIIVAARDKAF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtagcaccgcagcgacgtctaaattacctctagaagtagaactttcgaggaac
tctaaaggactgattataattttatcttccccttcaggtacaggtaagtcgagtttagct
aaagcattattgaaaatagataataatttgcgtttatctatttcggcaactacaagaaaa
ccacgtttaggagaagtagagggcataaactattactttaagaccggtctagagtttgaa
gaattagttaagcagaataaattccttgaatatgctaaaatatacgatgattattacggt
acgcctaaagaatatgtcgaaatgttattaaatcaaggcttggatgttttgtttgatatt
gattggcaaggagcaaggagtattaagaaaaatgctactaatgttgttgctatatttgta
ttgcctcctaatattgaagtattggaacaacgcttaagaaatagagcgaccgataatgaa
gaagcaataaaattacgtatgcagtcggcacaaaacgaaatatcacatgctaatgagtat
gattatgtagttactaacgatgactttgaccggacgcttaaaaaaatacatgcgattata
gttgcagcacgagacaaagcgttttga

DBGET integrated database retrieval system