KEGG   Rickettsia slovaca 13-B: Rsl_204Help
Entry
Rsl_204           CDS       T01671                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rsv  Rickettsia slovaca 13-B
Pathway
rsv00020  Citrate cycle (TCA cycle)
rsv00190  Oxidative phosphorylation
rsv00650  Butanoate metabolism
rsv01100  Metabolic pathways
rsv01110  Biosynthesis of secondary metabolites
rsv01120  Microbial metabolism in diverse environments
rsv01130  Biosynthesis of antibiotics
rsv01200  Carbon metabolism
Module
rsv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rsv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rsl_204 (sdhD)
   00650 Butanoate metabolism
    Rsl_204 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Rsl_204 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS tRNA_anti_2 PAP2
Motif
Other DBs
NCBI-ProteinID: AEV91838
Position
171669..172049
Genome map
AA seq 126 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW
ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV
ALFYKG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacagggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgttgtgg
gaacttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtat
catgcgatgcttggtatgcgtgtagtaattgaagattatataagttatcacaaattacgt
aatacattgattataatagtgcaattattttgcattgttactattgtagcttttgtagta
gcgttgttttataaaggataa

DBGET integrated database retrieval system