KEGG   Rickettsia slovaca 13-B: Rsl_399Help
Entry
Rsl_399           CDS       T01671                                 

Gene name
cycM
Definition
(GenBank) Cytochrome c
  KO
K08738  cytochrome c
Organism
rsv  Rickettsia slovaca 13-B
Pathway
rsv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rsl_399 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Senescence_reg SDF
Motif
Other DBs
NCBI-ProteinID: AEV91988
Position
complement(343497..344024)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTALEQ
APVNIPELMKTANANNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHQPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcactagagcaa
gcaccggtaaatataccggaattaatgaagactgctaacgccaataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgctttcttacatcaa
ccaagtagctatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system