KEGG   Rickettsia slovaca 13-B: Rsl_472Help
Entry
Rsl_472           CDS       T01671                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rsv  Rickettsia slovaca 13-B
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rsv00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404257..405033
Genome map
AA seq 258 aa AA seqDB search
MNDNLINALKDLIINTGKIALDIKKAGMLTDIKSDGSVVTNADKEISKIIYQTLQTLTSQ
IAIVCEEQPLPIFSSDTFWLIDPIDGTWSYVNGKSTYTVNIGLIENGFPTIGLIYHPETA
KLYYTDVNGRLKIEQNSKEIFVNHEPKHEELNAVIGFYNSNKATKEFLSKYSFGQINAIG
SSMKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNILDTHGQEITYGKESFANPN
FFACSKYWLEREARLHRY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaatttaattaatgctttaaaagatttaattattaataccggcaagattgca
ctagatataaaaaaggcaggaatgttgactgatattaaatcagatgggtcagtagtcact
aatgccgataaagaaattagtaaaataatttatcaaactctacaaaccttaacctctcaa
atagctatagtatgtgaagagcagccgctacctatattcagcagtgatactttttggtta
atcgatcctattgatgggacatggagctatgtaaacggtaaaagtacatatacggtcaat
atagggcttattgaaaacggttttccaaccatcggcttgatatatcaccctgaaacagca
aagctatattatactgatgtaaacggtcggttaaaaatcgaacagaattctaaagaaata
tttgttaatcatgaacctaaacatgaagagcttaatgcggtaataggtttttataattca
aataaagctactaaagaatttttaagtaagtattcattcggtcaaataaatgcaataggc
agttcaatgaaactatgcttaattgctgaaggagcagctgatatatatccaaaattcggt
caaactatggaatgggacatagcggcaggtcatgctttaattaaagccggcggtggtaat
attttagatacgcatggacaagaaattacttacggtaaagaaagtttcgctaatcctaat
tttttcgcctgtagtaaatattggttggaaagggaggcaaggttgcatagatactag

DBGET integrated database retrieval system