KEGG   Rickettsia slovaca 13-B: Rsl_918Help
Entry
Rsl_918           CDS       T01671                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rsv  Rickettsia slovaca 13-B
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rsv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(759535..760536)
Genome map
AA seq 333 aa AA seqDB search
MNFMYPHIRLRRNRKAFWLRELISESNLSVSDLVLPLFVVEGHNERQEIKTMPGIYRLSI
DQIVETAKEAAELGINVIALFPSIDQSLKSENADEAYNLDNLICRTIRSIKNANIDIGII
CDVALDPYTTHGHDGIVHHGEVDNDRSVRALCNQALVLAKAGVDIVAPSDMMDGRIRAIR
EYLDKEGFINVGILAYAAKYASSFYGPFRDAVKSNKKNYLDKSSYQMDVRNIKEAMLEIE
HDIAEGADMVMVKPGMPFLDVIREAANNLNAKIFAYQVSGEYAMLKFAAEAGAMDWERAL
MESLISFKRAGATGIFTYAALEVAEILKNNKIK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaattttatgtacccccatattagacttagaagaaatagaaaagctttttggcttaga
gagttaatatccgaaagtaatttatcggttagtgatttagtgttgcctttatttgttgtt
gaaggacataatgaaaggcaagaaattaaaactatgcctggtatatatcgtttatcgatt
gatcaaatagtagaaacggcaaaagaagcagcagagctgggtattaatgttattgcatta
tttccgagtattgatcaaagtctaaaaagtgaaaatgccgatgaggcttataatttagat
aatttaatatgtagaactattagaagcatcaaaaacgctaatatcgatattggtataata
tgcgatgtagcacttgatccttatactacacatggtcatgatggtattgtgcatcatggg
gaagttgataatgatagatcagtaagagctttgtgtaatcaggcattagtgctagcaaaa
gctggagtagatattgttgcaccttccgatatgatggatggaagaatcagggctataagg
gaatatcttgacaaagagggatttataaatgttggaattcttgcttatgccgctaaatat
gcttcaagtttttacggtccgtttcgcgatgctgttaagagtaataaaaagaattattta
gataaatcaagctatcaaatggatgtacgtaatattaaggaagcaatgcttgagattgag
catgatatagcagagggagccgatatggtaatggtgaagcctggtatgccgtttttggat
gttattcgtgaagcggcaaataatttaaatgctaaaatttttgcatatcaggttagtgga
gaatatgcaatgttaaaatttgcagcagaagcaggggcaatggattgggagagagctttg
atggagtcattaattagttttaaacgtgccggtgccacaggtatatttacctatgcagct
cttgaagtagctgaaatattaaagaacaataaaattaagtag

DBGET integrated database retrieval system