KEGG   Rickettsia slovaca D-CWPP: MC3_00235Help
Entry
MC3_00235         CDS       T01801                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MC3_00235
   00670 One carbon pool by folate
    MC3_00235
Enzymes [BR:rsw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MC3_00235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37553..37945)
Genome map
AA seq 130 aa AA seqDB search
MKNRKIIGIMACDPQGVIGNKGQIPWSYTKEFEYFYQTVKNNIIVMGRKTFDSIPTKILK
NCICIVFSRNTPLQSYNNIFFIKSLDDFWQVIKPFTDKKIFMVGGTEIATLFLEQNLIDE
FLLTKINKNL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagaaaaatcatcggtataatggcatgtgacccacaaggggtgataggtaat
aaaggtcagataccttggtcttatactaaggagtttgaatatttttatcagacggtaaaa
aataatattatagtcatgggacgaaaaacctttgactctatacctacaaagattttaaaa
aattgtatttgtattgttttttcaagaaatacaccattacaatcttataataatatattt
tttattaaatccttagatgatttttggcaggtaataaaaccttttactgataaaaaaatt
tttatggttggagggacagaaatagcaactcttttcctagaacaaaatcttattgatgaa
tttttacttacaaaaataaataaaaatctgtaa

DBGET integrated database retrieval system