KEGG   Rickettsia slovaca D-CWPP: MC3_00370Help
Entry
MC3_00370         CDS       T01801                                 

Definition
Acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rsw01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rsw01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(57663..58856)
Genome map
AA seq 397 aa AA seqDB search
MLSKLNKPALFALIFYPIFIISLVVKYSFDYGIGLTEVIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQDQDPHTPLKFDNKFLGF
MWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIAAFMNIVVPLFIGYLVGG
TMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGAKWYHLDVHKWIIFLMSKIGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSFVEIQESLKNLAEQVSAATQI
TEKSSERLLKIVNKKIIDAEQSIYKLYNQLNTLKVSN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcctgctttatttgctttaatattttatcctatttttatt
atatctcttgtagttaaatattcgtttgattatggaatagggctaactgaagttattttt
ataattgctagttattatattaataatattaccgttgggatcggtctgcataggttatgg
tctcataatgcctataaaataaataaatatgccgagtttgtcttaattatgctgtctgca
ggaacattacaaggaccagctttatcttgggcatcgaatcattataaacatcatagatat
acggatcaagaccaagatccgcatactcctttaaaatttgataataaatttttaggcttt
atgtggtctcatataggatggatgctagtcggaagcggtagctataagtctattgatcgc
attacttgggctaagcacgggaaaaacaatttattaaaatggcagctaaaatattattgg
caaatagcagcttttatgaatattgtcgtgcctttatttatcggttacttagtcggtggt
actatgcaatcggcatatgcaggatttttatttatggggctcggtagattcctacagcag
caagcaaccttctgcgttaattctttatgccactttgccggtagtaaaaaatattacaaa
ggcactgccggagatatttggtggatggcattattcttactcggtgaaaattggcataat
taccatcatgcttttccttcagattatcgtaacggtgcaaaatggtatcatttggacgtt
cacaaatggataatatttttaatgagtaaaatcggtttagcttcagaacttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgaaaaacaa
aagcaaaaattgactttaatgcaaactaaaatagatcatttattagaaaatctatgctta
aaaattaaagagcttgaagaatcatctattactatcaaagaacaatttaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcggagcaagtaagtgctgcaacgcaaata
acagaaaaatcttcggaaagactattaaaaatagttaataaaaaaattattgatgccgaa
caatctatttataagctgtataatcaattaaataccttaaaggtatctaattag

DBGET integrated database retrieval system