KEGG   Rickettsia slovaca D-CWPP: MC3_00985Help
Entry
MC3_00985         CDS       T01801                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MC3_00985
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC3_00985
   00650 Butanoate metabolism
    MC3_00985
  Energy metabolism
   00190 Oxidative phosphorylation
    MC3_00985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171679..172059
Genome map
AA seq 126 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMLW
ELKKPFNVVALLITVVISLYHAMLGMRVVIEDYISYHKLRNTLIIIVQLFCIVTIVAFVV
ALFYKG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacagggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgttgtgg
gaacttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtat
catgcgatgcttggtatgcgtgtagtaattgaagattatataagttatcacaaattacgt
aatacattgattataatagtgcaattattttgcattgttactattgtagcttttgtagta
gcgttgttttataaaggataa

DBGET integrated database retrieval system