KEGG   Rickettsia slovaca D-CWPP: MC3_01940Help
Entry
MC3_01940         CDS       T01801                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
rsw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsw00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MC3_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Senescence_reg SDF
Motif
Other DBs
NCBI-ProteinID: AFD19352
UniProt: H8LNB7
Position
complement(343506..344033)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTALEQ
APVNIPELMKTANANNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHQPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcactagagcaa
gcaccggtaaatataccggaattaatgaagactgctaacgccaataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgctttcttacatcaa
ccaagtagctatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system