KEGG   Rickettsia slovaca D-CWPP: MC3_01940Help
Entry
MC3_01940         CDS       T01801                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rsw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MC3_01940
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MC3_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343506..344033)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSENQNTTALEQ
APVNIPELMKTANANNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHQPSSYAPGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcgttgcggttcaagaatcatcagaaaatcaaaatactaccgcactagagcaa
gcaccggtaaatataccggaattaatgaagactgctaacgccaataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgctttcttacatcaa
ccaagtagctatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system