KEGG   Rickettsia slovaca D-CWPP: MC3_04445Help
Entry
MC3_04445         CDS       T01801                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
rsw00860  Porphyrin and chlorophyll metabolism
rsw01100  Metabolic pathways
rsw01110  Biosynthesis of secondary metabolites
rsw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MC3_04445
Enzymes [BR:rsw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MC3_04445
Exosome [BR:rsw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC3_04445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2 UxuA
Motif
Other DBs
NCBI-ProteinID: AFD19810
UniProt: H8LNL7
Position
complement(759546..760547)
Genome map
AA seq 333 aa AA seqDB search
MNFMYPHIRLRRNRKAFWLRELISESNLSVSDLVLPLFVVEGHNERQEIKTMPGIYRLSI
DQIVETAKEAAELGINVIALFPSIDQSLKSENADEAYNLDNLICRTIRSIKNANIDIGII
CDVALDPYTTHGHDGIVHHGEVDNDRSVRALCNQALVLAKAGVDIVAPSDMMDGRIRAIR
EYLDKEGFINVGILAYAAKYASSFYGPFRDAVKSNKKNYLDKSSYQMDVRNIKEAMLEIE
HDIAEGADMVMVKPGMPFLDVIREAANNLNAKIFAYQVSGEYAMLKFAAEAGAMDWERAL
MESLISFKRAGATGIFTYAALEVAEILKNNKIK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaattttatgtacccccatattagacttagaagaaatagaaaagctttttggcttaga
gagttaatatccgaaagtaatttatcggttagtgatttagtgttgcctttatttgttgtt
gaaggacataatgaaaggcaagaaattaaaactatgcctggtatatatcgtttatcgatt
gatcaaatagtagaaacggcaaaagaagcagcagagctgggtattaatgttattgcatta
tttccgagtattgatcaaagtctaaaaagtgaaaatgccgatgaggcttataatttagat
aatttaatatgtagaactattagaagcatcaaaaacgctaatatcgatattggtataata
tgcgatgtagcacttgatccttatactacacatggtcatgatggtattgtgcatcatggg
gaagttgataatgatagatcagtaagagctttgtgtaatcaggcattagtgctagcaaaa
gctggagtagatattgttgcaccttccgatatgatggatggaagaatcagggctataagg
gaatatcttgacaaagagggatttataaatgttggaattcttgcttatgccgctaaatat
gcttcaagtttttacggtccgtttcgcgatgctgttaagagtaataaaaagaattattta
gataaatcaagctatcaaatggatgtacgtaatattaaggaagcaatgcttgagattgag
catgatatagcagagggagccgatatggtaatggtgaagcctggtatgccgtttttggat
gttattcgtgaagcggcaaataatttaaatgctaaaatttttgcatatcaggttagtgga
gaatatgcaatgttaaaatttgcagcagaagcaggggcaatggattgggagagagctttg
atggagtcattaattagttttaaacgtgccggtgccacaggtatatttacctatgcagct
cttgaagtagctgaaatattaaagaacaataaaattaagtag

DBGET integrated database retrieval system