KEGG   Rickettsia slovaca D-CWPP: MC3_07205Help
Entry
MC3_07205         CDS       T01801                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rsw  Rickettsia slovaca D-CWPP
Brite
Enzymes [BR:rsw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     MC3_07205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210125..1210250)
Genome map
AA seq 41 aa AA seqDB search
MQQKLNRGEYANAANELLRWMCAKGGLKLQGLVKRRQYYRL
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcaaaagctaaaccgaggtgaatatgcaaacgctgctaacgagttactgcgatgg
atgtgtgctaaaggcggtcttaagctgcaaggcttagtgaaacgtcggcaatattataga
ttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system