KEGG   Rickettsia slovaca D-CWPP: MC3_07480Help
Entry
MC3_07480         CDS       T01801                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rsw  Rickettsia slovaca D-CWPP
Pathway
rsw00300  Lysine biosynthesis
rsw01100  Metabolic pathways
rsw01120  Microbial metabolism in diverse environments
rsw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsw00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MC3_07480
Enzymes [BR:rsw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MC3_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFD20331
UniProt: H8LNX9
Position
complement(1257038..1258183)
Genome map
AA seq 381 aa AA seqDB search
MYINYLKDLIGFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSN
EPNICFVGHVDVVLAGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFIK
NNTDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIG
RRGSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTNI
EVSNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKQHCKEYKVDYKLEYSSSAES
FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY
TKISDLQKLYDVYYNFLMEIL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacattaactacttaaaagatttgattggttttaagtctgtaactcctaagagcgat
ggggctattgagtatattaatgatttgcttaaacagcacggctttaagaccgaaataaaa
atattcggtgattctaaaagtgagcaagtcactaatctttatgctgttttcggtagcaat
gagcctaatatttgctttgttggtcatgtagatgtagtgttggcaggcaatcatgagctt
tggcataatgcgagtccatttaaagttagccagcaagatggtaagatatatggcagaggt
gcggtggatatgaaaggggctatagcgtgctttctagctgccagtttagattttataaaa
aataataccgattttaaaggttccattagtttcttacttactagtgatgaagagggaaaa
gcaaagcatggtactaaagaaatgctgcaatatatttatgatcaaggatataagataaat
tttgctattgtcggtgaacctacttgtgaaaaagaaataggcgatgcaattaagattggc
agaagaggaagtgttaactttaaattaaatatagaaggcttaagcgggcatgtagcttat
cctcataaagcaaataacccattgccttgcttaataataatattgaatgagttaacaaat
ataaaacttgatgaaggtactgaattttttcaacgttcaaatcttgaagtaacgaatatc
gaggtcagtaataatacttcaaacgtaattccggcaagtacggaagcatctttcaatata
cgttttaataatttacatagtgcagaaactttagcaaaacaggtagaagaaattattaaa
cagcattgtaaagaatataaagtagattataagttagaatatagtagttctgctgaaagt
tttattcagaaccctagcgataaaataaaagaatttgctaaagtagtagagcatacgctt
aaaataaagcctgaattctctacaagcggcggtacgtcggatgcaagattcgtcaaaaat
tattgtccgttagtagagtttggtttattatccgaaacggcacataaaataaacgaatac
acaaaaattagcgatttacaaaaattatatgatgtgtattataactttttgatggaaata
ctttga

DBGET integrated database retrieval system