KEGG   Ramlibacter tataouinensis: Rta_02140Help
Entry
Rta_02140         CDS       T01544                                 

Definition
Protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rta  Ramlibacter tataouinensis
Brite
Enzymes [BR:rta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rta_02140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(218238..219122)
Genome map
AA seq 294 aa AA seqDB search
MTGRRGSATACHATRRRHHAQHRAAPQLYAEYLAASAGGRHPGLLAAFRTAPREAFVGPG
PWRVFTWSGYIDTPDDDPRWVYQDILIALDEALGLNNGQPSLHARCLAAAAPAPGDTVLH
VGAGTGYYTAVLAELVGPGGQVHAFELEPGLAHRAKNCLASYGRVRVDNRSAAEGDLPAA
DVIYVSAGATHPVRGWLEALRIGGRLVFPLTGGGAGVLLVIRRVAPERWTAQGLMPTAFT
PCAGARDDVSAEGLPNAMRQRPYQDIRSLRLDTAPDATAWHAGRGWWLSTAEPT
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcagaagaggctccgccaccgcgtgtcatgcaaccagaaggaggcaccatgcc
cagcatcgagcagcaccgcagctctatgccgagtacctggctgcatcggccggcggcagg
cacccaggactgcttgcggcctttcgaaccgcgccgcgcgaggcgtttgtcgggccggga
ccttggcgcgtctttacctggagcggctacatcgacacgccagacgacgacccgcgctgg
gtctaccaggacatcctcatcgcgctggacgaggcgctcggattgaacaacggccaaccc
tcgctgcatgcccggtgcctggctgcggccgcgcccgcgccgggcgacaccgttctccac
gtgggtgccgggaccggctactacacggccgtgctggctgaattggtcggtccaggcgga
caggtgcacgccttcgaactggaacccgggctggcacaccgcgcgaagaactgcctggca
agctacgggcgggtacgggtggacaaccgttcggcagcagagggtgacttgccggcggcg
gacgtgatctatgtgtccgccggggcaacgcaccccgtgcgcggctggctggaggcacta
cggatcggcggccggctggtcttcccgctgaccggtggcggcgccggcgtgctgctggtc
atccgacgcgttgcgcccgagcgctggaccgcccagggcttgatgccgacggccttcacg
ccttgcgcgggcgcacgagacgacgtttcggccgaaggcctgccgaacgccatgcgccag
cgtccttaccaggacatccgctcgctgcgcctcgacaccgcgccggacgcgacggcgtgg
catgccggccgcggctggtggctgtccactgccgagccgacgtga

DBGET integrated database retrieval system