KEGG   Ramlibacter tataouinensis: Rta_02700Help
Entry
Rta_02700         CDS       T01544                                 

Gene name
glcB
Definition
(RefSeq) Malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rta  Ramlibacter tataouinensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rta_02700 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rta_02700 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    Rta_02700 (glcB)
Enzymes [BR:rta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rta_02700 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(270964..273162)
Genome map
AA seq 732 aa AA seqDB search
MTARTQIHGLQVDGQLARFIDEQVLPGTGVDRAAFWKGFDAIVHELAPRNAALLAERDRL
QAELDGWHRAHPGPVRDMAGYRGFLEKIGYLVPQPRGVKATTANVDAELALQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDALPETGGADRGPGYNEVRGARVIEYARHVLDRTA
PLQQGSHVDSTGYQVEGGQLVVALRGGKASRLQDPAQFIGYQGEPAQPSSVLLRHHGLHL
DIRIDRTHRIGATDPAGVSDLVLESALSTILDLEDSIAAVDAQDKLLAYANWLGILKGTL
TEQVSKGGRSFTRGLNGDRVYRSPRGDGEVRLHGRSLLFLRNVGHLMTNPAILWGPQAKE
IPEGIMDAVVTTAIALHDLQGRGANGIRNSRTGSVYIVKPKMHGPKEVAFASELFGRVEQ
LLGLPANTVKLGIMDEERRTSVNLQACIAEAAARVAFINTGFLDRTGDEMHTAMLAGPML
RKGDMKSSAWIQAYEKNNVLVGLSCGLRGRAQIGKGMWAMPDLMAAMLEQKIAHPKAGAN
TAWVPSPTAATLHALHYHQVDVSQVQQELEKTDAQAQRESLLAGLLTIPVVPEAKWSPQE
RQQELDNNVQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLEHGVV
TREQVLQTFQRMAAVVDRQNAGDPLYRPMAGHWDSSHAYRAALDLVFKGKEQPSGYTEPL
LHAWRLKVKSAG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcacccagatccacggcctgcaagtggacggccagctggcgcgcttcatc
gacgagcaggtgctgcccggcaccggcgtcgaccgcgccgccttctggaaaggcttcgac
gccatcgtccacgagctggcgcccaggaacgccgcgctgctggccgagcgcgaccggctg
caggccgagctggacggctggcaccgcgcccaccccggcccggtccgggacatggcgggc
taccgcggtttcctggagaagatcggctacctggtgccgcagccgcgcggcgtgaaggcc
accaccgccaacgtcgacgccgagctggcgctgcaggccggcccgcagctggtggtgccc
atcctcaacgcccgctacgcgctcaacgccgccaacgcgcgctggggttcgctgtacgac
gccctgtacggcaccgatgccctgccggaaaccggcggcgccgaccggggccccggctac
aacgaggtgcgcggcgccagggtgatcgagtacgcgcgccacgtgctggaccgcaccgcg
ccgctgcagcagggatcgcatgtcgattccaccggctaccaggtcgagggcggccagctg
gtggtcgcgctcaggggcggcaaggccagccggctgcaggacccggcgcagttcatcggc
taccagggcgagcccgcgcagccctcgtccgtgctgctgcgccaccacggcctgcacctg
gacatccgcatcgaccgcacccatcgcatcggcgccaccgacccggcgggcgtgagcgac
ctggtgctggagtccgcgctgtccaccatcctggacctggaggattcgatcgccgcggtg
gacgcgcaggacaagctgctggcctatgccaactggctgggcatcctgaagggcacgctg
accgagcaggtcagcaagggcggcaggagcttcacccgcggcctgaacggcgaccgcgtc
taccgctcgccccggggcgacggcgaggtgcgcctgcacggccgctcgctgctgttcctg
cgcaatgtgggccacctgatgaccaacccggccatcctgtggggaccccaggccaaggag
atccccgagggcatcatggacgcggtggtcaccaccgccatcgcgctgcacgacctgcaa
ggcaggggtgcgaacgggatccgcaactcgcgcaccggctcggtctacatcgtcaagccc
aagatgcacggcccgaaggaagtggccttcgccagcgagctgttcggccgcgtcgagcag
ctgctgggcctgccggccaacaccgtcaagctgggcatcatggacgaggagcgccgcacc
agcgtcaacctgcaggcctgcatcgccgaggcggccgcccgcgtggccttcatcaacacc
ggcttcctggaccgcaccggcgacgagatgcacaccgccatgctggccggcccgatgctg
cgcaagggcgacatgaagtcctcggcctggatccaggcctacgagaagaacaacgtgctg
gtgggcctgtcctgcgggctgcgcggccgggcccagatcggcaagggcatgtgggccatg
ccggacctgatggccgccatgctggagcagaagatcgcccaccccaaggccggtgccaac
accgcctgggtgccctcgcccacggccgccacgctgcacgcgctgcactaccaccaggtc
gacgtctcgcaggtgcagcaggagctggagaagaccgacgcgcaggcgcagcgcgagagc
ctgctggccggcctgctcaccatccccgtggtgcccgaagccaagtggagcccgcaggag
cgccagcaggagctggacaacaacgtgcagggcatcctgggctacgtggtgcgctggatc
gaccagggcgtgggctgctccaaggtgcccgacatccacaacgtgggcctgatggaggac
cgcgccacgctgcgcatctccagccagcacatcgccaactggctggagcacggcgtggtc
acgcgcgagcaggtgctgcagaccttccagcgcatggccgccgtggtggacaggcagaac
gccggcgacccgctgtaccggccgatggccggccactgggacagcagccacgcttaccgc
gcggcgctggacctggtgttcaagggcaaggagcagccttcgggctacaccgagccgctg
ctgcacgcctggcggctgaaggtcaagtccgccggctga

DBGET integrated database retrieval system