KEGG   Ramlibacter tataouinensis: Rta_03150Help
Entry
Rta_03150         CDS       T01544                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rta  Ramlibacter tataouinensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rta_03150 (hemB)
Enzymes [BR:rta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rta_03150 (hemB)
Exosome [BR:rta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rta_03150 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(323931..324941)
Genome map
AA seq 336 aa AA seqDB search
MTLHAPYPHGRPRRLRRDDFTRNLVREHTLTPHDLIYPVFVLDGRGRREAVASMPGVERL
SLDLLLPVAEDCVALGIPVMALFPVIDASLKTEDGREAWNAEGLVPRVVRELKQRFPQLG
VMTDVALDPFTSHGQDGLLDATGYILNDETVQVLTRQALVQAEAGVDIVAPSDMMDGRIG
AIRAALESRGAIHTRIMAYSAKYASAFYGPFRDAVGSAANLGKGNKKVYQMDPGNTDEAL
REVALDIAEGADMVMVKPGMPYLDVVRRVKDEFRVPTFAYQVSGEYAMLKAAAGNGWLDH
DAVMMESLLAFKRAGADGVLTYFALDAARALLGGRQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcatgcaccgtacccgcacggccgcccgcgccggctgcgccgcgacgacttc
acgcgcaacctggtgcgcgagcacacactgacgccgcacgacctgatctacccggtgttc
gtgctggacggccgcggccggcgcgaagccgtggcctccatgcccggcgttgagcgcctg
agcctggacctgctgctgccggtggccgaggactgcgtggcgctgggcatcccggtgatg
gcgctgttcccggtgatcgacgcctcgctcaagaccgaggacggccgcgaggcctggaac
gccgagggcctggtgccccgggtggtgcgcgaactcaagcagcgcttcccgcagctgggc
gtgatgaccgacgtggcgctggaccccttcaccagccatggccaggacggcctgctggat
gccacgggctacatcctcaacgacgagaccgtgcaggtgctgacccgccaggcgctggtg
caggccgaggccggcgtggacatcgtcgcgcccagcgacatgatggacggccggatcggc
gcgatccgggcggcgctcgaatcgcgcggcgcgatccacacccggatcatggcctacagc
gccaagtacgccagcgcgttctacgggccgttccgcgacgcggtcggctcggccgccaac
ctgggcaagggcaacaagaaggtctaccagatggacccgggcaacaccgacgaggcgctg
cgcgaggtggccctggacatcgccgagggtgccgacatggtgatggtcaagcccggcatg
ccctacctggacgtggtgcgccgcgtgaaggacgagttccgcgtgcccaccttcgcctac
caggtctcgggcgagtacgccatgctcaaggctgccgcgggcaacggctggctggaccac
gacgccgtgatgatggaaagcctgctggccttcaagcgcgctggcgccgacggcgtgctc
acctacttcgcgctggacgctgcccgtgccctgctcggcgggcggcagtag

DBGET integrated database retrieval system