KEGG   Ramlibacter tataouinensis: Rta_03970Help
Entry
Rta_03970         CDS       T01544                                 

Definition
(S)-2-haloacid dehalogenase
Orthology
K01560  
2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rta  Ramlibacter tataouinensis
Pathway
Chlorocyclohexane and chlorobenzene degradation
Chloroalkane and chloroalkene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:rta00625]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:rta00361]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
400533..401252
Genome map
AA seq 239 aa AA seqDB search
MDLNTRPTVLLFDVNETLLDVGAVKRQVGDLLQEPGAGTLWFTTMLHYSLVLTVSGQYAG
FPEIGAAALRMLARNADLGLSQQDALAVMAGMRTAAAHPEVIPALERLQRAGFRMASLTN
STQAGAEAQLAHAGLDRFFERQLSVQGTGKFKPHRDVYLWAADEMGVQPSECMLVAAHGW
DVAGAAWAGMRTAFVAREGQQKFPLAPEPALDVPDLAALATRLTATQAPSPQARPGTAP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaacacccgtccgaccgtcctgttgttcgacgtcaacgagacattgctggac
gtcggcgccgtgaagcgccaggtcggcgacctgctgcaggaacccggcgcggggacgctc
tggttcaccaccatgctgcactactccctggtcctgaccgtcagcggccagtacgcggga
ttcccggagatcggcgccgccgcgctgcggatgctggcgcgcaatgccgacctgggcctg
tcgcagcaagacgccttggccgtgatggcggggatgcgcaccgcggctgcccatcccgag
gtgatccccgcgctggagcggctgcagcgggcggggttccgcatggccagcctgacgaat
tcgacgcaggccggcgccgaggcgcagctggcgcacgccggcctcgaccggttcttcgaa
cggcagctgagcgtgcagggtaccggcaagttcaagccgcaccgcgacgtctacctgtgg
gcggcggacgaaatgggtgtgcagccctccgaatgcatgctggtcgccgcccatggctgg
gacgtcgcgggcgctgcctgggccgggatgcggacggcgttcgtcgcgcgcgaaggccag
cagaagttcccgctggcgcccgagcccgcgctggacgttcccgacctggcggccctggcc
acccggctcaccgcaacgcaggcgccatcacctcaggcccgccccgggacagctccatga

DBGET integrated database retrieval system