KEGG   Ramlibacter tataouinensis: Rta_03970Help
Entry
Rta_03970         CDS       T01544                                 

Definition
(S)-2-haloacid dehalogenase
Orthology
K01560  
2-haloacid dehalogenase [EC:3.8.1.2]
Organism
rta  Ramlibacter tataouinensis
Pathway
Chlorocyclohexane and chlorobenzene degradation
Chloroalkane and chloroalkene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rta_03970
   00361 Chlorocyclohexane and chlorobenzene degradation
    Rta_03970
Enzymes [BR:rta01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Rta_03970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
400533..401252
Genome map
AA seq 239 aa AA seqDB search
MDLNTRPTVLLFDVNETLLDVGAVKRQVGDLLQEPGAGTLWFTTMLHYSLVLTVSGQYAG
FPEIGAAALRMLARNADLGLSQQDALAVMAGMRTAAAHPEVIPALERLQRAGFRMASLTN
STQAGAEAQLAHAGLDRFFERQLSVQGTGKFKPHRDVYLWAADEMGVQPSECMLVAAHGW
DVAGAAWAGMRTAFVAREGQQKFPLAPEPALDVPDLAALATRLTATQAPSPQARPGTAP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaacacccgtccgaccgtcctgttgttcgacgtcaacgagacattgctggac
gtcggcgccgtgaagcgccaggtcggcgacctgctgcaggaacccggcgcggggacgctc
tggttcaccaccatgctgcactactccctggtcctgaccgtcagcggccagtacgcggga
ttcccggagatcggcgccgccgcgctgcggatgctggcgcgcaatgccgacctgggcctg
tcgcagcaagacgccttggccgtgatggcggggatgcgcaccgcggctgcccatcccgag
gtgatccccgcgctggagcggctgcagcgggcggggttccgcatggccagcctgacgaat
tcgacgcaggccggcgccgaggcgcagctggcgcacgccggcctcgaccggttcttcgaa
cggcagctgagcgtgcagggtaccggcaagttcaagccgcaccgcgacgtctacctgtgg
gcggcggacgaaatgggtgtgcagccctccgaatgcatgctggtcgccgcccatggctgg
gacgtcgcgggcgctgcctgggccgggatgcggacggcgttcgtcgcgcgcgaaggccag
cagaagttcccgctggcgcccgagcccgcgctggacgttcccgacctggcggccctggcc
acccggctcaccgcaacgcaggcgccatcacctcaggcccgccccgggacagctccatga

DBGET integrated database retrieval system