KEGG   Ramlibacter tataouinensis: Rta_04320Help
Entry
Rta_04320         CDS       T01544                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rta_04320
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rta_04320
Enzymes [BR:rta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rta_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436976..437905
Genome map
AA seq 309 aa AA seqDB search
MGPMDETRRTIALIGAPTDVGASVRGAGMGPDALRVAGLADALRAHRFTVVDRGNLAGPP
NPGLAPEGGLRHLQEVVTWNRSVFDAVDAALGQGEFPLLMGGDHCLAIGSISAVAWHCRR
QGKQLRVIWLDAHTDVNTEAISPSGNIHGMPVACLLGHGPASLVGWSGERAALEPQDIDF
IGIRSVDRDEKQAIRQLGLQVYDMRHIDEHGMRNTMTEALHDIGDNTHLHVSFDLDCLDP
MDAPGVGTGVRGGPTYREIQLCMEMIADTGRMGSLDVVEINPALDVRNRTAELAVEFVQS
LFGASTLAR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggggccgatggacgagacccgcaggaccattgccctcatcggcgcgcccaccgacgtg
ggcgccagcgtgcgcggcgccggcatggggccggacgcactgcgcgtggcgggcctggcc
gatgccctgcgcgcgcaccggttcacggtggtggaccgcggcaacctggccggcccgccc
aacccggggctggcgcccgaaggcggcctgcgccacctgcaggaggtggtcacctggaac
cgctcggtgttcgacgcggtcgacgcggcgctggggcagggcgagttcccgctgctgatg
ggcggcgaccactgcctggccatcggctccatcagcgccgtcgcctggcactgccggcgc
cagggcaagcagctgcgcgtgatctggctggacgcccacaccgacgtcaacaccgaggcc
atcagccccagcggcaacatccacggcatgccggtggcctgcctgctgggccacggcccg
gcctccctggtgggctggagcggcgagcgcgcggcgctggagccgcaggacatcgacttc
atcggcatccgcagcgtggaccgggacgagaagcaggccatccgccagctggggctgcag
gtctacgacatgcgccacatcgacgagcacggcatgcgcaacaccatgaccgaggcgctg
cacgacatcggcgacaacacgcacctgcacgtgagcttcgacctggactgcctggacccg
atggacgcgccgggcgtgggcaccggcgtgcgcggcggccccacctaccgcgagatccag
ctgtgcatggagatgatcgccgacaccggccgcatgggctcgctggacgtggtggagatc
aaccctgcgctggacgtgcgcaaccgcacggcggagctggccgtcgagttcgtgcagagc
ctgttcggcgcttccacgctggcgcgctga

DBGET integrated database retrieval system