KEGG   Ramlibacter tataouinensis: Rta_04320Help
Entry
Rta_04320         CDS       T01544                                 

Definition
(GenBank) Candidate Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00220  Arginine biosynthesis
rta00330  Arginine and proline metabolism
rta01100  Metabolic pathways
rta01110  Biosynthesis of secondary metabolites
rta01130  Biosynthesis of antibiotics
rta01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rta_04320
   00330 Arginine and proline metabolism
    Rta_04320
Enzymes [BR:rta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rta_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEG91503
UniProt: F5Y5Z9
Position
436976..437905
Genome map
AA seq 309 aa AA seqDB search
MGPMDETRRTIALIGAPTDVGASVRGAGMGPDALRVAGLADALRAHRFTVVDRGNLAGPP
NPGLAPEGGLRHLQEVVTWNRSVFDAVDAALGQGEFPLLMGGDHCLAIGSISAVAWHCRR
QGKQLRVIWLDAHTDVNTEAISPSGNIHGMPVACLLGHGPASLVGWSGERAALEPQDIDF
IGIRSVDRDEKQAIRQLGLQVYDMRHIDEHGMRNTMTEALHDIGDNTHLHVSFDLDCLDP
MDAPGVGTGVRGGPTYREIQLCMEMIADTGRMGSLDVVEINPALDVRNRTAELAVEFVQS
LFGASTLAR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggggccgatggacgagacccgcaggaccattgccctcatcggcgcgcccaccgacgtg
ggcgccagcgtgcgcggcgccggcatggggccggacgcactgcgcgtggcgggcctggcc
gatgccctgcgcgcgcaccggttcacggtggtggaccgcggcaacctggccggcccgccc
aacccggggctggcgcccgaaggcggcctgcgccacctgcaggaggtggtcacctggaac
cgctcggtgttcgacgcggtcgacgcggcgctggggcagggcgagttcccgctgctgatg
ggcggcgaccactgcctggccatcggctccatcagcgccgtcgcctggcactgccggcgc
cagggcaagcagctgcgcgtgatctggctggacgcccacaccgacgtcaacaccgaggcc
atcagccccagcggcaacatccacggcatgccggtggcctgcctgctgggccacggcccg
gcctccctggtgggctggagcggcgagcgcgcggcgctggagccgcaggacatcgacttc
atcggcatccgcagcgtggaccgggacgagaagcaggccatccgccagctggggctgcag
gtctacgacatgcgccacatcgacgagcacggcatgcgcaacaccatgaccgaggcgctg
cacgacatcggcgacaacacgcacctgcacgtgagcttcgacctggactgcctggacccg
atggacgcgccgggcgtgggcaccggcgtgcgcggcggccccacctaccgcgagatccag
ctgtgcatggagatgatcgccgacaccggccgcatgggctcgctggacgtggtggagatc
aaccctgcgctggacgtgcgcaaccgcacggcggagctggccgtcgagttcgtgcagagc
ctgttcggcgcttccacgctggcgcgctga

DBGET integrated database retrieval system