KEGG   Ramlibacter tataouinensis: Rta_04400Help
Entry
Rta_04400         CDS       T01544                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rta  Ramlibacter tataouinensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rta02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rta02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447832..448809
Genome map
AA seq 325 aa AA seqDB search
MTSAPVVVIGASFGGVNALLELAAALPPDFPAIVGVVLHVGSRASILPQLLSRRGPHPAV
HPKDGEPPRPGVLYVAPPDHHLLLTPQAVRLNRGPRENYARPAIDPLFRSAALGWRERAI
GVILTGDLDDGTAGLAAIKRCGGMAVVQDPQEAVGPSMPASALAHVQVDHCVRLAQLAPL
LAKLVGQPARSPATVPQDLQREQALFEGNDPMDQLAHLGEPSLLTCPDCGGGLVELKGSQ
PLRYRCHTGHGFTARSLEAAQQEQADHALWSSLRSLQERRLLLLRLATVAEATGDVAQAQ
AGRRQAERLREQAEQLSRMIESADA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgctcccgtggtggtgatcggtgcctccttcgggggcgtcaacgccttgctc
gaactggccgccgcgttgccgccggacttccccgccatcgtgggggtggtgctgcacgtg
ggcagccgcgccagcatcctgccccagctcctcagccggcgcggaccccatccggcggtg
cacccgaaggacggcgagccgccccggcccggggtgctgtacgtcgccccgccggaccac
cacctgctgctcacgccgcaggcggtccgcctgaaccgcgggccgcgcgagaactatgcg
cgcccggccatcgaccccctgttccgcagcgccgccctgggctggcgcgagcgcgccatc
ggcgtcatcctcaccggcgacctcgacgacggcacggccggcctggccgccatcaagcgg
tgcgggggcatggcggtggtgcaggacccgcaggaagcggtggggcccagcatgccggcc
agcgcgctggcccatgtgcaggtcgaccactgcgtgcggctggcgcagctggcgccgctg
ctcgcgaagctggtgggccagcccgcccggtcgcccgccacggtgccgcaagacttgcaa
agggagcaggccctgttcgaaggaaacgatcccatggaccaactcgcgcatctcggagag
ccctccctgctgacctgtcccgactgcggcggcggcctggtcgagctgaaggggtcgcag
ccgctgcgctaccgctgccacaccggccacggcttcaccgcccgctcgctggaggcggcg
cagcaggagcaggccgaccacgcgctgtggagcagcctgcgctcgctgcaggagcgcagg
ctgctgctgctgcgcctggccaccgtggccgaggccacgggcgatgtggcgcaggcgcag
gcgggccgccgccaggccgagcgtctgcgcgagcaggccgaacagctgagcagaatgatc
gagtcagcggacgcataa

DBGET integrated database retrieval system