KEGG   Ramlibacter tataouinensis: Rta_04410Help
Entry
Rta_04410         CDS       T01544                                 

Definition
hybrid histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rta  Ramlibacter tataouinensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rta00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rta_04410
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rta_04410
Enzymes [BR:rta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Rta_04410
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rta_04410
Two-component system [BR:rta02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Rta_04410
Bacterial motility proteins [BR:rta02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rta_04410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448837..453462
Genome map
AA seq 1541 aa AA seqDB search
MSAQPEAEQHQEPPTDGLDDAVPSQGYRLIPLVGLGGSAGAIPVLQQFFRAVPAEAGLAF
VVVIHLNAEHESTLAELLQRTTRMRVTQLTERQRVEPNTVYVIPPGKSIKVGDGFLRLDS
LQPERRHVAVDLFFRSLADAHGPHSAAVVLSGADGDGAIGIKRIKERGGLTIAQDPQECE
HGGMPRSAIATGMVDWVLPVADMAPRLLAYFRLEKALRLPAEEAPPAAAAPPGGPGPAGD
GEEAPLRDVLAFLRTRTGRDFSAYKRATIVRRIARRMQVNGTDNLHGYLNCLRTRPGEAG
ALLQDLLISVTNFFRDADCFGALEAHLGELFRDRAPGDTLRVWVPACATGEEAYSLAILL
CERARQLDAPPVIQIFATDLDEEAIRVGREAVYPATIEADVPQEHLRRYFLKEHQGYRVR
REVRELVLFAQHDVLRDSPFSRLDLVSCRNLLIYLNREAQQRVFQTFHFALQPHGRLFLG
ASESIEEAGGLFSVIDKKNRIFGLRPAPRLSPPTPHGPSSLALALDLPPALAEAPAIPGR
GLQPVVAPVRAHRAGEAGRGTSWGEVHFKLLEVLAPPSVLVDAEHEILHLSPQAGRFLQY
GGGEPSRNLMRAVHPSLRIELRAALFQAAQTQQTAEVVATPVELAGQPMEVQLRVSPTLE
LAPDLFMVMFSARPVDAARAPALAGPERAGADPVAHHLDRELERLKSHLRDTVEQYEAST
EELKASNEELQAMNEELRSATEELETSREELQSINEELSTVNYELKAKVEELAHANSDIH
NLMDATEIATVFLDRELRVMRYTPSAVRIFNLIPTDLGRPLADLATRLEYRELGDDARRV
LERLIPVEREVGLADGNWFLTRLLPYRTLDDRIAGVVLSFIDITERKKAEEVRLWLSAVV
NSTSDGIVSFAPDLTVLSWNSGCERIFGWSAQEMIGQSLALTAPSQEERLRANVRLLEEG
RDLHFETLRWRKDGTEIQVALSISPIRDPDGRVIGGTAIVRDVTETRRAQEQLRASEERL
RLIVENARDFAIFSLDPERRVTAWNSGAQRLLGYSEEEVLGRSGDVIFTEGDRAAGAAEA
EARKALAEGRAEDERPHRRKDGSTFWASGVAMRMDDAAGTAVGFVKILRDQTEQREAREA
LVRSQGELVRALEDNLRARRELEAADAAKDRFLAVLSHELRNPLASISSASEMLAAPDTS
GDDLRRAADVVRRQADAMRELLDDLLDVSRLRLGRLTLKRQPVLLADVVAAALESTRPLV
RAAGHRLTVRLPQEPLWLQADPLRLGQLLSNLIGNAAKYTPHGGKIELSAEADPEQVVVT
VADNGIGIDPSEIERMFDLFTQAHDERGRPNDGLGIGLALSRSIAELHGGWLRAASAGRG
QGSRFQLGLPLHRPGAAEGAAAAAAPASSPPAAEPGGGELVLIADDNVDAAWALAKLMEL
SGFQVVAVHSGEEALRLAQARRPAIMLVDIGMPDLSGHEVARRVRAGAGGQDVMLVAVTG
WGQEGDQRDSLAAGFDAHLTKPLNMGRLKSLLAELRRRRAR
NT seq 4626 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacaacccgaagcagaacagcaccaagaacccccgacggatggcctggacgac
gcggtgcccagccaggggtatcgcctgattccgctggtggggctgggcggctcggccggg
gcgatccccgtgctgcagcagttcttccgcgctgtgccggccgaggccggcctggccttc
gtggtcgtcatccacctcaatgcggagcacgaaagcacgctggccgagctgctgcagcgc
accactcgcatgcgcgtcacgcagctgaccgagcgccagcgcgtggagcccaacaccgtc
tacgtcatcccgcccggcaagtccatcaaggtgggcgacggcttcctgcggctggacagc
ctgcagcccgagcgccggcacgtggcggtggacctgttcttccgctcgctggccgacgcg
cacgggccgcactcggcggcggtggtgctgtcgggcgcggacggcgacggcgccatcggc
atcaagcggatcaaggagcgcggcggcctgaccatcgcgcaggacccgcaggagtgcgag
catggcggcatgccgcgcagcgcgatcgccaccggcatggtcgactgggtgctgccggtg
gccgacatggcgccgcggctgctggcctacttccgcctcgagaaggccctgcggctgccg
gccgaggaggcgcccccggcggcggccgcgccgcccgggggcccggggccggcgggcgac
ggcgaggaggcgcccctgcgcgacgtgctggccttcctgcgcacccgcaccggccgcgac
ttctcggcctacaagcgggccaccatcgtgcggcgcatcgcccgccgcatgcaggtcaac
ggcaccgacaacctgcacggctacctgaactgcctgcgcacccggcccggggaggcgggc
gcgctgctgcaggacctgctgatcagcgtcaccaacttcttccgcgacgccgactgcttc
ggcgcgctggaggcgcacctgggcgagctgttccgtgacagggcgccgggcgacacgctg
cgcgtctgggtgccggcctgcgccaccggcgaggaggcctattcgctggccatcctgctg
tgcgagcgggcccggcagctcgacgcgccgccggtgatccagatcttcgccaccgacctg
gacgaggaggccatccgggtggggcgcgaggcggtgtatccggccaccatcgaggccgac
gtgccgcaggagcacctgcgccgctacttcctcaaggagcaccagggctaccgggtgcgc
cgcgaggtgcgcgagctggtgctgttcgcccagcacgacgtgctcagggactcgccgttc
tcgcggctggacctggtctcctgccgcaacctgctgatctacctgaaccgcgaggcgcag
cagcgcgtgttccagaccttccacttcgccctgcagccccacgggcggctgttcctgggc
gcctcggagtcgatcgaggaggccggcggcctgttctcggtcatcgacaagaagaaccgc
atcttcggcctgcggccggcaccgcgcctgagcccgccgacgccgcacggcccgagctcg
ctggcgctggcgctggacctgccgccggcgctggccgaggcgcccgcgatccccggccgc
ggcctgcagccggtggtcgcgccggtgcgtgcgcaccgggccggcgaggccggccgcggc
acctcctggggcgaggtgcacttcaagctgctggaggtgctggcgccgccctcggtgctg
gtggacgcggagcacgagatcctgcacctgtcgccacaggccggccgcttcctgcagtac
ggcggcggcgaacccagccgcaacctgatgcgcgccgtgcaccccagcctgcgcatcgag
ctgcgcgcggccctgttccaggcggcccagacgcagcagaccgccgaggtggtcgccacc
ccggtggagctcgcgggccagccgatggaggtgcagctgcgcgtgagccccacgctcgag
ctggcgccggacctgttcatggtgatgttctcggcccgtccggtggatgccgcgcgcgct
cccgccctggcggggccggagcgcgccggggccgacccggtggcccaccacctcgaccgc
gaactggagcggctgaaatcgcacctgcgcgacacggtggagcagtacgaggcctccacc
gaggagctcaaggccagcaacgaggaactgcaggccatgaacgaggagctgcgctcggcc
accgaggaactggagaccagccgcgaggagctgcagtccatcaacgaggagctctccacg
gtcaactacgagctcaaggccaaggtggaggagctggcgcacgccaacagcgacatccac
aacctgatggacgcgaccgagatcgccacggtgttcctggaccgcgagctgcgcgtgatg
cgctacacgccgtcggccgtgcgcatcttcaacctgatccccaccgacctgggccggccg
ctggccgacctggcgacccggctggagtaccgcgagctgggcgacgacgcccggcgggtg
ctggagcggctgatcccggtcgagcgcgaggtcgggctggcggacggcaactggttcctc
acgcgcctgctgccctaccgcaccctggacgaccgcatcgccggcgtggtgctgtccttc
atcgacatcaccgagcgcaagaaggccgaggaggtgcggctgtggctgtcggccgtggtc
aactcgaccagcgacggcatcgtcagcttcgcgccggatctcaccgtgctgagctggaac
tcgggctgcgagcgcatcttcggctggagcgcgcaggagatgatcgggcagtcgctggcc
ctgacggcgccaagccaggaggagcggctgcgcgccaacgtgcgcctgctggaggagggc
cgggacctccatttcgaaaccctgcgctggcgcaaggacggcaccgagatccaggtggcc
ctgtccatctcgcccatccgcgaccccgacggccgggtgatcggcggcaccgccatcgtg
cgcgacgtcaccgagacgcggcgcgcgcaggagcagctgcgcgccagcgaggagcggctg
cgcctgatcgtggagaacgcgcgcgacttcgccatcttctcgctcgacccggagcgccgc
gtcacggcctggaacagcggcgcccagcgcctgctcggctactccgaggaggaggtgctc
ggccgcagcggcgacgtgatcttcaccgagggcgaccgggccgccggcgctgcggaagcc
gaggcgcgcaaggcgctggccgagggccgggccgaggacgagcggccgcaccggcgcaag
gacggcagcaccttctgggccagcggcgtggccatgcgcatggacgacgcggcgggcacg
gcggtgggcttcgtcaagatcctgcgcgaccagaccgagcagcgcgaagcgcgcgaggcg
ctggtgcgcagccagggcgagctggtgcgcgcgctggaggacaacctgcgcgcgcggcgc
gagctggaggcggccgacgcggccaaggaccgcttcctggccgtgctgtcgcacgagctg
cgcaacccgctggcttccatcagcagcgcctcggagatgctggccgcgccggatacgtcc
ggcgacgacctgcgccgcgccgccgacgtggtgcggcgccaggccgacgccatgcgcgag
ctgctggacgacctgctggacgtttcgcggctgcgcctggggcggctgacgctcaagcgc
cagccggtcctgctggcggacgtggtggccgccgcgctggagagcacgcggccgctggtg
cgcgccgccggccaccggctgacggtgcgcctgccgcaggagccgctgtggctgcaggcc
gacccgctgcggctggggcagctgctgtccaacctgatcggcaacgcggccaagtacacg
ccccacggcgggaagatcgagctgtcggccgaggccgacccggagcaggtggtcgtcacc
gtggccgacaacggcatcgggatagatccgtccgagatcgagcgcatgttcgacctgttc
acgcaggcccatgacgagcgcggccggcccaacgacggcctgggcatcgggctggcgctg
tcgcgcagcatcgccgaactgcacggcggctggctgcgcgccgcctcggccggccgcggc
cagggcagccggttccagctgggcctgcccctgcaccggcccggcgcggccgaaggcgcg
gcagcggccgcggcgccggcttcctccccgccggcggcggagccgggtggcggggaactg
gtgctgatcgccgacgacaacgtcgacgccgcctgggcgctggccaagctgatggagctg
tcgggcttccaggtggtggcggtgcacagcggcgaagaggcgctgcggctggcccaggcc
cggcggccggccatcatgctggtggacatcggcatgcccgacctcagcggccacgaagtg
gcgcggcgcgtgcgcgccggcgcgggcggccaggacgtgatgctggtggcggtgacgggc
tggggccaggaaggcgaccagcgcgactccctggccgccggcttcgacgcccaccttacc
aagccgctgaacatgggccggctcaagtcgctgctggctgagctgcggcggcgccgcgcg
cgctga

DBGET integrated database retrieval system