KEGG   Ramlibacter tataouinensis: Rta_04410Help
Entry
Rta_04410         CDS       T01544                                 

Definition
hybrid histidine kinase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rta  Ramlibacter tataouinensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rta02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rta02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448837..453462
Genome map
AA seq 1541 aa AA seqDB search
MSAQPEAEQHQEPPTDGLDDAVPSQGYRLIPLVGLGGSAGAIPVLQQFFRAVPAEAGLAF
VVVIHLNAEHESTLAELLQRTTRMRVTQLTERQRVEPNTVYVIPPGKSIKVGDGFLRLDS
LQPERRHVAVDLFFRSLADAHGPHSAAVVLSGADGDGAIGIKRIKERGGLTIAQDPQECE
HGGMPRSAIATGMVDWVLPVADMAPRLLAYFRLEKALRLPAEEAPPAAAAPPGGPGPAGD
GEEAPLRDVLAFLRTRTGRDFSAYKRATIVRRIARRMQVNGTDNLHGYLNCLRTRPGEAG
ALLQDLLISVTNFFRDADCFGALEAHLGELFRDRAPGDTLRVWVPACATGEEAYSLAILL
CERARQLDAPPVIQIFATDLDEEAIRVGREAVYPATIEADVPQEHLRRYFLKEHQGYRVR
REVRELVLFAQHDVLRDSPFSRLDLVSCRNLLIYLNREAQQRVFQTFHFALQPHGRLFLG
ASESIEEAGGLFSVIDKKNRIFGLRPAPRLSPPTPHGPSSLALALDLPPALAEAPAIPGR
GLQPVVAPVRAHRAGEAGRGTSWGEVHFKLLEVLAPPSVLVDAEHEILHLSPQAGRFLQY
GGGEPSRNLMRAVHPSLRIELRAALFQAAQTQQTAEVVATPVELAGQPMEVQLRVSPTLE
LAPDLFMVMFSARPVDAARAPALAGPERAGADPVAHHLDRELERLKSHLRDTVEQYEAST
EELKASNEELQAMNEELRSATEELETSREELQSINEELSTVNYELKAKVEELAHANSDIH
NLMDATEIATVFLDRELRVMRYTPSAVRIFNLIPTDLGRPLADLATRLEYRELGDDARRV
LERLIPVEREVGLADGNWFLTRLLPYRTLDDRIAGVVLSFIDITERKKAEEVRLWLSAVV
NSTSDGIVSFAPDLTVLSWNSGCERIFGWSAQEMIGQSLALTAPSQEERLRANVRLLEEG
RDLHFETLRWRKDGTEIQVALSISPIRDPDGRVIGGTAIVRDVTETRRAQEQLRASEERL
RLIVENARDFAIFSLDPERRVTAWNSGAQRLLGYSEEEVLGRSGDVIFTEGDRAAGAAEA
EARKALAEGRAEDERPHRRKDGSTFWASGVAMRMDDAAGTAVGFVKILRDQTEQREAREA
LVRSQGELVRALEDNLRARRELEAADAAKDRFLAVLSHELRNPLASISSASEMLAAPDTS
GDDLRRAADVVRRQADAMRELLDDLLDVSRLRLGRLTLKRQPVLLADVVAAALESTRPLV
RAAGHRLTVRLPQEPLWLQADPLRLGQLLSNLIGNAAKYTPHGGKIELSAEADPEQVVVT
VADNGIGIDPSEIERMFDLFTQAHDERGRPNDGLGIGLALSRSIAELHGGWLRAASAGRG
QGSRFQLGLPLHRPGAAEGAAAAAAPASSPPAAEPGGGELVLIADDNVDAAWALAKLMEL
SGFQVVAVHSGEEALRLAQARRPAIMLVDIGMPDLSGHEVARRVRAGAGGQDVMLVAVTG
WGQEGDQRDSLAAGFDAHLTKPLNMGRLKSLLAELRRRRAR
NT seq 4626 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacaacccgaagcagaacagcaccaagaacccccgacggatggcctggacgac
gcggtgcccagccaggggtatcgcctgattccgctggtggggctgggcggctcggccggg
gcgatccccgtgctgcagcagttcttccgcgctgtgccggccgaggccggcctggccttc
gtggtcgtcatccacctcaatgcggagcacgaaagcacgctggccgagctgctgcagcgc
accactcgcatgcgcgtcacgcagctgaccgagcgccagcgcgtggagcccaacaccgtc
tacgtcatcccgcccggcaagtccatcaaggtgggcgacggcttcctgcggctggacagc
ctgcagcccgagcgccggcacgtggcggtggacctgttcttccgctcgctggccgacgcg
cacgggccgcactcggcggcggtggtgctgtcgggcgcggacggcgacggcgccatcggc
atcaagcggatcaaggagcgcggcggcctgaccatcgcgcaggacccgcaggagtgcgag
catggcggcatgccgcgcagcgcgatcgccaccggcatggtcgactgggtgctgccggtg
gccgacatggcgccgcggctgctggcctacttccgcctcgagaaggccctgcggctgccg
gccgaggaggcgcccccggcggcggccgcgccgcccgggggcccggggccggcgggcgac
ggcgaggaggcgcccctgcgcgacgtgctggccttcctgcgcacccgcaccggccgcgac
ttctcggcctacaagcgggccaccatcgtgcggcgcatcgcccgccgcatgcaggtcaac
ggcaccgacaacctgcacggctacctgaactgcctgcgcacccggcccggggaggcgggc
gcgctgctgcaggacctgctgatcagcgtcaccaacttcttccgcgacgccgactgcttc
ggcgcgctggaggcgcacctgggcgagctgttccgtgacagggcgccgggcgacacgctg
cgcgtctgggtgccggcctgcgccaccggcgaggaggcctattcgctggccatcctgctg
tgcgagcgggcccggcagctcgacgcgccgccggtgatccagatcttcgccaccgacctg
gacgaggaggccatccgggtggggcgcgaggcggtgtatccggccaccatcgaggccgac
gtgccgcaggagcacctgcgccgctacttcctcaaggagcaccagggctaccgggtgcgc
cgcgaggtgcgcgagctggtgctgttcgcccagcacgacgtgctcagggactcgccgttc
tcgcggctggacctggtctcctgccgcaacctgctgatctacctgaaccgcgaggcgcag
cagcgcgtgttccagaccttccacttcgccctgcagccccacgggcggctgttcctgggc
gcctcggagtcgatcgaggaggccggcggcctgttctcggtcatcgacaagaagaaccgc
atcttcggcctgcggccggcaccgcgcctgagcccgccgacgccgcacggcccgagctcg
ctggcgctggcgctggacctgccgccggcgctggccgaggcgcccgcgatccccggccgc
ggcctgcagccggtggtcgcgccggtgcgtgcgcaccgggccggcgaggccggccgcggc
acctcctggggcgaggtgcacttcaagctgctggaggtgctggcgccgccctcggtgctg
gtggacgcggagcacgagatcctgcacctgtcgccacaggccggccgcttcctgcagtac
ggcggcggcgaacccagccgcaacctgatgcgcgccgtgcaccccagcctgcgcatcgag
ctgcgcgcggccctgttccaggcggcccagacgcagcagaccgccgaggtggtcgccacc
ccggtggagctcgcgggccagccgatggaggtgcagctgcgcgtgagccccacgctcgag
ctggcgccggacctgttcatggtgatgttctcggcccgtccggtggatgccgcgcgcgct
cccgccctggcggggccggagcgcgccggggccgacccggtggcccaccacctcgaccgc
gaactggagcggctgaaatcgcacctgcgcgacacggtggagcagtacgaggcctccacc
gaggagctcaaggccagcaacgaggaactgcaggccatgaacgaggagctgcgctcggcc
accgaggaactggagaccagccgcgaggagctgcagtccatcaacgaggagctctccacg
gtcaactacgagctcaaggccaaggtggaggagctggcgcacgccaacagcgacatccac
aacctgatggacgcgaccgagatcgccacggtgttcctggaccgcgagctgcgcgtgatg
cgctacacgccgtcggccgtgcgcatcttcaacctgatccccaccgacctgggccggccg
ctggccgacctggcgacccggctggagtaccgcgagctgggcgacgacgcccggcgggtg
ctggagcggctgatcccggtcgagcgcgaggtcgggctggcggacggcaactggttcctc
acgcgcctgctgccctaccgcaccctggacgaccgcatcgccggcgtggtgctgtccttc
atcgacatcaccgagcgcaagaaggccgaggaggtgcggctgtggctgtcggccgtggtc
aactcgaccagcgacggcatcgtcagcttcgcgccggatctcaccgtgctgagctggaac
tcgggctgcgagcgcatcttcggctggagcgcgcaggagatgatcgggcagtcgctggcc
ctgacggcgccaagccaggaggagcggctgcgcgccaacgtgcgcctgctggaggagggc
cgggacctccatttcgaaaccctgcgctggcgcaaggacggcaccgagatccaggtggcc
ctgtccatctcgcccatccgcgaccccgacggccgggtgatcggcggcaccgccatcgtg
cgcgacgtcaccgagacgcggcgcgcgcaggagcagctgcgcgccagcgaggagcggctg
cgcctgatcgtggagaacgcgcgcgacttcgccatcttctcgctcgacccggagcgccgc
gtcacggcctggaacagcggcgcccagcgcctgctcggctactccgaggaggaggtgctc
ggccgcagcggcgacgtgatcttcaccgagggcgaccgggccgccggcgctgcggaagcc
gaggcgcgcaaggcgctggccgagggccgggccgaggacgagcggccgcaccggcgcaag
gacggcagcaccttctgggccagcggcgtggccatgcgcatggacgacgcggcgggcacg
gcggtgggcttcgtcaagatcctgcgcgaccagaccgagcagcgcgaagcgcgcgaggcg
ctggtgcgcagccagggcgagctggtgcgcgcgctggaggacaacctgcgcgcgcggcgc
gagctggaggcggccgacgcggccaaggaccgcttcctggccgtgctgtcgcacgagctg
cgcaacccgctggcttccatcagcagcgcctcggagatgctggccgcgccggatacgtcc
ggcgacgacctgcgccgcgccgccgacgtggtgcggcgccaggccgacgccatgcgcgag
ctgctggacgacctgctggacgtttcgcggctgcgcctggggcggctgacgctcaagcgc
cagccggtcctgctggcggacgtggtggccgccgcgctggagagcacgcggccgctggtg
cgcgccgccggccaccggctgacggtgcgcctgccgcaggagccgctgtggctgcaggcc
gacccgctgcggctggggcagctgctgtccaacctgatcggcaacgcggccaagtacacg
ccccacggcgggaagatcgagctgtcggccgaggccgacccggagcaggtggtcgtcacc
gtggccgacaacggcatcgggatagatccgtccgagatcgagcgcatgttcgacctgttc
acgcaggcccatgacgagcgcggccggcccaacgacggcctgggcatcgggctggcgctg
tcgcgcagcatcgccgaactgcacggcggctggctgcgcgccgcctcggccggccgcggc
cagggcagccggttccagctgggcctgcccctgcaccggcccggcgcggccgaaggcgcg
gcagcggccgcggcgccggcttcctccccgccggcggcggagccgggtggcggggaactg
gtgctgatcgccgacgacaacgtcgacgccgcctgggcgctggccaagctgatggagctg
tcgggcttccaggtggtggcggtgcacagcggcgaagaggcgctgcggctggcccaggcc
cggcggccggccatcatgctggtggacatcggcatgcccgacctcagcggccacgaagtg
gcgcggcgcgtgcgcgccggcgcgggcggccaggacgtgatgctggtggcggtgacgggc
tggggccaggaaggcgaccagcgcgactccctggccgccggcttcgacgcccaccttacc
aagccgctgaacatgggccggctcaagtcgctgctggctgagctgcggcggcgccgcgcg
cgctga

DBGET integrated database retrieval system