KEGG   Ramlibacter tataouinensis: Rta_04560Help
Entry
Rta_04560         CDS       T01544                                 

Gene name
glpK
Definition
ATP:glycerol 3-phosphotransferase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rta_04560 (glpK)
Enzymes [BR:rta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rta_04560 (glpK)
Exosome [BR:rta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rta_04560 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467444..468937
Genome map
AA seq 497 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDGQGRIVAQAQRELPQIFPQPGWVEHDAMEIWRGQLATARE
ALAQAGIHAREVRALGITNQRETTVLWNRATGQPIHHAIVWQDRRTEPLCVRLREQGHEA
LIRSRTGLVIDAYFAATKIAWLLENVPGAREQALRGELAFGTIDSWLLWQLTGGALHATD
VSNASRSMLFDIHRNRWDDELLALLDIPASLMPSVLPSSAAYGPTRADLLGAPIAIGGVA
GDQQSALFGQACFAPGMAKNTYGTGCFMLMHMGGRFQRSANGLITTSAAQASARPEFALE
GSVFVGGAVVQWLRDGLKAIRSSAEIEALAASVPDTGGVTLVPAFTGLGAPYWQPDARGT
LTGLTRGTTIAHVARAALESIACQSAALLQAMSRDAQVAGGAPLAELRVDGGASVNDLLM
QFQADLLGIPVVRPAVTETTALGAAYLAGLSAGVFGGTADLTALWRAERHFEPAWDRGRA
AEHMARWEHAVRQATAS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctgctcgccctggaccagggcacctccagctcgcgcagcatcgtgttcgac
ggccagggccgcatcgtggcccaggcgcagcgcgagctgccgcagatcttcccgcagccc
ggctgggtcgagcacgacgcgatggagatctggcgcggccagctggccaccgcgcgcgag
gcactggcccaggccggcatccatgcgcgcgaggtgcgcgcgctgggcatcaccaaccag
cgcgagaccacggtgctgtggaaccgcgcgacgggccagcccatccatcacgccatcgtc
tggcaggaccggcgcaccgagcccctgtgcgtccggctgcgcgagcagggccacgaggcg
ctgatccgctcgcgcacggggctggtgatcgacgcctacttcgccgccaccaagatcgcc
tggctgctcgaaaacgtgcccggcgcgcgcgagcaggcgctgcggggcgagctggccttc
ggcaccatcgacagctggctgctgtggcagctgacgggcggcgccctccatgccaccgac
gtgagcaatgcctcccgcagcatgctgttcgatatccaccgcaaccgctgggacgacgag
ctgctggcactgctggacatccctgcctccttgatgccctcggtgctgccctccagcgcc
gcgtacgggcccacgcgggccgatctgctgggtgcgcccatcgccatcggcggcgtggcc
ggcgaccagcagagcgcgctgttcggccaggcctgcttcgcgcccggcatggccaagaac
acctacggcaccggctgcttcatgctgatgcacatgggcgggcgcttccagcgctcggcc
aatgggctgatcaccaccagcgcggcgcaggccagcgcccggcccgagttcgcgctggag
ggaagcgtgttcgtcggcggcgccgtggtgcagtggctgcgcgacggcctcaaggccatc
aggagcagcgccgagatcgaggccctggccgccagcgtgcccgacaccggcggcgtcacc
ctggtgccggccttcaccggcctgggcgcgccgtactggcagcccgacgcccgcggcacc
ctgaccggcctgacccgcggcaccaccatcgcccacgtggcgcgcgccgcgctggagagc
atcgcctgccagagcgcggcgctgctgcaggccatgagccgcgacgcccaggtcgccggc
ggcgccccgctggccgagctgcgcgtggacggcggcgccagcgtgaacgacctgctgatg
cagttccaggccgacctgctgggcatcccggtcgtgcggccggcggtgaccgagaccacg
gcgctgggagccgcctacctggcggggctgtcggccggcgtgttcggcggcaccgccgac
ctgacggccctgtggcgcgccgaacgtcacttcgagccggcctgggaccgcggccgcgcg
gccgagcacatggcgcgctgggagcacgcggtgcggcaggccaccgcttcctga

DBGET integrated database retrieval system