KEGG   Ramlibacter tataouinensis: Rta_04810Help
Entry
Rta_04810         CDS       T01544                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rta01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rta01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
494657..495631
Genome map
AA seq 324 aa AA seqDB search
MSTYSETAPAAAVQQEDATPPRSRAVVYDRRLVGTKNFYAGLTVTVPTLFTAYAVFLAFR
EGVSGLDIAMCLVMYLLTLMGITVGFHRLLAHRSFVADRWVKIVFAVFGTWAAQAPVIHW
VANHRRHHATSDQPGDPHSPHLSGSTLSGRIKGLWHAHIGSMFAPEVTNYATFGPDLLRD
PDIRWLNNNYLWVVLSGLALPAAIGGLVTQSWWGAWTALVWGGFVRMFVVHHAIWAITSI
AHTVGRRVYESGDHARNFALLALVTGGEGWHSTHHAFPRTAIFSTAPWQIDIGGIFIWAL
EKMGAAREVNRLTPEQMRAKALYR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtattcggagaccgctcccgcagcagcggtgcaacaagaagatgccacaccc
ccgcgtagcagggccgtcgtctacgaccgcaggctggttggcacgaagaacttctatgcc
gggctcaccgtgaccgtgcccacgctgttcaccgcgtacgcggtctttctcgctttccgc
gagggcgtgagcggcctggatatcgccatgtgcctggtgatgtacctgctcacgctgatg
ggcatcacggtggggttccaccggctgctggcgcaccgctccttcgtcgccgaccgctgg
gtgaagatcgtgttcgcggtcttcggcacctgggccgcccaggcgcccgtgatccattgg
gtggccaaccatcgcagacaccatgcgacctccgaccagccgggcgatccgcattcgccc
catctgtcgggcagcacgctgagcgggcgcatcaagggactgtggcacgcgcacatcggc
tcgatgtttgcgccggaggtgaccaactacgcgaccttcgggcccgatctgctgcgcgac
cccgacatccgctggctcaacaacaactacctgtgggtcgtgctgtccggcctggcgctg
ccggcggccatcggcggcctcgtcacacagagctggtggggcgcatggaccgctctggtg
tggggcggcttcgtgcgcatgttcgtcgtgcaccacgcgatctgggccatcacctccatt
gcgcacaccgtaggccgccgcgtgtatgagtccggcgaccacgcgcgcaacttcgcgctg
ctcgcgctcgtcacgggcggcgagggctggcacagcacgcaccatgcgtttccgcgcacc
gcgatcttctcgaccgcgccgtggcagatcgacatcggcggcatcttcatctgggcgctg
gaaaagatgggcgcggcgcgcgaagtcaaccgcctcacacccgaacagatgcgcgcgaaa
gcgctttaccgctga

DBGET integrated database retrieval system