KEGG   Ramlibacter tataouinensis: Rta_07120Help
Entry
Rta_07120         CDS       T01544                                 

Gene name
ruvA
Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rta  Ramlibacter tataouinensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rta00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rta_07120 (ruvA)
Enzymes [BR:rta01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rta_07120 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743408..743989
Genome map
AA seq 193 aa AA seqDB search
MIGRLIGTLADKNPPQVLLDCQGVGYEVDVPMSTFYHLPGLGEKVTLLTHFVVREDAQVL
YGFGSTGEREAFRQLIKISGVGPRTALSVLSGLSVADIAQAVTAQDAGRLVKVPGIGKKT
AERLLLELKGKIGADLGAPAGGAGAASDAQADILQALQTLGYSDKEAQAALRALPKDVGV
SEGIKLALKALTK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgataggcagattgataggaacgctcgcggacaagaacccgccccaggtgctgctggac
tgccagggcgtgggctacgaggtggacgtgcccatgagcaccttctaccacctgccgggc
ctgggtgagaaggtcacgctgctgacgcatttcgtggtgcgcgaggacgcacaggtgctg
tacggcttcggcagcacaggcgagcgcgaggccttccgccagctgatcaagatctcgggc
gtgggcccgcgcaccgcgctgtcggtgctgtcgggcctgagcgtggccgacatcgcccag
gccgtcacggcccaggacgccggccggctggtcaaggtgcccggcatcggcaagaagacg
gccgagcggctgctgctggaactcaagggcaagatcggcgccgacctgggtgcgccggcc
ggcggcgccggcgctgccagcgatgcgcaggccgacatcctgcaggccctgcagaccttg
ggctacagcgacaaggaagcccaggccgcgctgcgggcgctgcccaaggacgtgggcgtg
agcgagggcatcaagctggcgctcaaggcgctgaccaagtga

DBGET integrated database retrieval system