KEGG   Ramlibacter tataouinensis: Rta_07340Help
Entry
Rta_07340         CDS       T01544                                 

Definition
N-acetylmannosamine kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rta_07340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rta_07340
   00052 Galactose metabolism
    Rta_07340
   00500 Starch and sucrose metabolism
    Rta_07340
   00520 Amino sugar and nucleotide sugar metabolism
    Rta_07340
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rta_07340
   00524 Butirosin and neomycin biosynthesis
    Rta_07340
Enzymes [BR:rta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rta_07340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
764343..765290
Genome map
AA seq 315 aa AA seqDB search
MQACVDIGGTKVAASLVQPGADLSRTLVHRQSEPTVKEGARTALAGQVLRLVDRACAQAG
IPASAITEVAVSSTGPFRLHGGRAELVTPNICGGMGEPGRLPNDWTSVPMEAPLAERFPA
VRMENDGIAALEAERRWGALQGLDHCAYVTWSTGVGTGLCVGGRVLRGKNGNAGHAGHSY
VADADPQALCGCGNRGDLESLVSGTAIRRRFGDRWPGASALMEAAGSGDAAALAVVDDLC
RVLGRALYNLAVTLDLQRISLGGSVFLHHQALLLPRLQAQLRGRLPALTDGCDIVAAGLG
ERVGDYAALALLAAP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcctgcgtcgacatcggtggcaccaaggtcgccgccagcctggtgcagccgggg
gcggacctgtcgcgcacgctggtgcaccgccagtccgaacccacggtgaaggagggcgcc
cgcacggcgctggcgggccaggtgctgcgcctggtcgaccgggcctgcgcgcaggcgggc
atccccgcctcggccatcaccgaagtggcggtgtcctccaccgggccgttccggctgcac
gggggccgggccgaactggtcacgcccaacatctgcggcggcatgggtgagcccgggcgc
ctgcccaacgactggacctccgtgcccatggaggcgccgctggccgaacgctttcccgcc
gtgcggatggagaacgacggcatcgccgccctggaggccgagcgccgctggggggcgctg
cagggcctggaccactgcgcgtacgtgacctggagcaccggcgtaggcaccgggctgtgc
gtgggcgggcgcgtgctgcgcggcaagaacggcaacgccggccatgccggccacagctat
gtggccgacgccgatccccaggccctgtgcggctgcggcaaccggggcgacctggagtcg
ctggtgtcgggcacggccatcaggaggcgcttcggcgaccgctggccgggtgcaagcgca
ctcatggaggccgcgggcagcggcgacgcggccgccctggcggtggtggacgatctgtgc
cgggtgctgggccgcgcgctgtacaacctggccgtcacgctggacctgcagcgcatcagc
ctgggaggcagcgtgttcctgcaccaccaggcactgctgctgccccggctgcaggcgcag
ctgcgcggccgcctgccggccctcaccgacgggtgcgacatcgtggcggccggcctgggc
gagcgcgtcggcgactacgccgcgctggccctgctggctgccccatga

DBGET integrated database retrieval system