KEGG   Ramlibacter tataouinensis: Rta_08280Help
Entry
Rta_08280         CDS       T01544                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rta00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
860345..861175
Genome map
AA seq 276 aa AA seqDB search
MALPTGDRCVAALQGAQVLSWTPAGSPGERLYLSPGAASDGATAIRGGVPLCFPQFNQRV
LGGRPLPKHGFARNRRWTPLGVVAEGEDRIAEFGLANDEETHALWPASFEARVAVRLSPG
RLAIGFRVRNTGWACWPFALALHTYLRVDDVTRASLHGLEGAAYWDAVADLDRPQARRFQ
SGALAVEGETDRVYAGGARVLRLSEPGRTLTVSQSTTLPDTVVWNPGAALCARLADMPAD
GWRHMLCVEAACIEEPVVLGPGQEWQGWQSFEVVAG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ttggcgctgcccacgggcgaccgctgcgtggccgccctgcagggagcgcaggtgctgtcc
tggacaccggccggcagccccggcgaacggctgtacctcagccccggcgcggccagcgat
ggcgccacagcgatccgcggcggcgtccccctgtgctttccgcagttcaaccagcgcgtg
ctgggcggccggccgctgcccaagcacggcttcgcccgcaaccggcgctggacgccgctt
ggcgtggtggccgaaggggaagaccgcatcgccgagttcgggttggccaacgacgaggag
acgcatgcgctctggcctgcttcgttcgaggcgcgggtggcggtgcgtctctcgcccggg
cggctggccatcggtttccgggtccgcaacacgggctgggcctgctggcccttcgctctg
gccctgcacacctacctgcgggtggacgacgtcacccgcgcgtcgctccatggcctggag
ggcgcggcctactgggacgccgtggccgatctggatcgtccccaggcgcggcgcttccag
agcggcgccctggccgtggagggcgagacggaccgggtgtacgcgggcggagcccgggtg
ctgcggctgagcgagcccggccggaccctgaccgtctcccagagcaccaccttgccggac
acggtggtgtggaatcctggcgccgcgctgtgcgcccggctggccgacatgcccgccgat
ggctggcgccacatgctgtgcgtggaggcggcgtgcatcgaggagccggtggtgctgggg
ccgggccaggagtggcagggctggcaatcgttcgaggtggtggcgggataa

DBGET integrated database retrieval system