KEGG   Ramlibacter tataouinensis: Rta_09640Help
Entry
Rta_09640         CDS       T01544                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rta  Ramlibacter tataouinensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rta_09640 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rta_09640 (murE)
Enzymes [BR:rta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Rta_09640 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995843..997327
Genome map
AA seq 494 aa AA seqDB search
MQALHSPGQAAQWLRSRVRGDLSADSRQVRAGDGFIAWPGAATDGRRYVGAALAQGAAAC
LVEAQGLQAYDFHGESVASYAGLKAATGPIAAAYYEQPTGRLDVLAVTGTNGKTSTAWWL
ALALSNLKQPGPMPCGLVGTLGIGQPPQVEFNGLTTPDPVLLQRWFRRFADQGLAACAIE
ASSVGIAERRLDGTRIRVAVFTNFSQDHLDYHASMDAYWAAKAELFRWPGLQAAVINIDD
ARGRPLAAGLEGGGLDLWTVSCEGPARLRATDIVHAAEGLRFTVAEGDRREPLPTRLVGQ
YNVSNLLGVVGAMRALGVPLADAVQACRGLLPVPGRMERFDAPGQPLVAVDYAHTPDALD
KALQALRPLAAQRGGRLWCVFGCGGDRDAGKRPLMAAVAEKSADRVVVTSDNPRREEPQA
IIGQILRGLARPEAAQVQADRARAIADAVAQAAPQDVVLLAGKGHEDYQEIAGARHPFDD
RLHAQAALARRPAP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgttgcacagccccggccaggccgcgcagtggctgcgctcgcgcgtgcgcggc
gacctgtcggccgacagccgccaggtgcgcgcgggcgacggcttcatcgcctggcccggc
gcggccacggacggccggcgctacgtcggcgccgccctggcgcagggcgccgcggcctgc
ctggtggaggcgcagggcctgcaggcctacgacttccacggcgaatccgttgccagctac
gccggcctgaaggccgccaccgggccgatcgcggccgcgtactacgagcagccgaccggg
cgcctggacgtgctcgccgtcaccggcaccaacggcaagacctccaccgcctggtggctg
gccctggcgctgtcgaacctgaagcagccgggcccgatgccgtgcggcctggtagggacc
ctgggcataggccagccgccgcaggtggagttcaacggcctgaccacgcccgacccggtg
ctgctgcagcgctggttccgccgcttcgccgaccagggcctggcggcctgcgccatcgag
gcctcgtcggtcggcatcgccgaacggcgcctggacggcacgcgcatccgagtggccgtg
ttcaccaatttcagccaggaccacctggactaccacgccagcatggacgcctactgggcg
gccaaggccgagctgttccgctggcccggcctgcaggcggccgtgatcaacatcgacgac
gcccgcggccgccccctggcggccggactggagggcggcggcctggacctctggacggtc
tcgtgcgaggggccggcgcgcctgcgggcgaccgacatcgtgcacgcggccgagggcctg
cgcttcacggtggccgagggcgaccggcgcgagccgctgcccacccggctggtcggccag
tacaacgtctccaacctgctgggcgtggtcggcgccatgcgcgcgctgggcgtgccgctg
gccgacgccgtgcaggcctgccgcggcctgctgccggtgccgggccggatggaacgcttc
gatgcgcccggccagccattggtggccgtggactacgcgcacacgcccgacgcgctggac
aaggccttgcaggcgctgcgcccgctggcggcgcagcgcggcggccggctgtggtgcgtg
ttcggctgcggcggcgaccgcgacgccggcaagcgcccgctgatggcggcggtggccgag
aagagcgccgaccgcgtcgtcgtgaccagcgacaacccgcgccgcgaggagccccaggcc
atcatcggccagatcctgcgcggcctggcgcgccccgaggcggcgcaggtgcaggccgac
cgggcccgcgccatcgccgacgcggtggcgcaggcggcgccgcaggacgtggtcctgctg
gccggcaagggccacgaggactaccaggagatcgccggcgccaggcatccgttcgacgac
cgcctgcatgcgcaggccgcgctggcccggaggcccgccccgtga

DBGET integrated database retrieval system