KEGG   Ramlibacter tataouinensis: Rta_10360Help
Entry
Rta_10360         CDS       T01544                                 

Definition
endo-1,4-glucanase, Glycoside Hydrolase Family 5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rta  Ramlibacter tataouinensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rta00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1072305..1073423)
Genome map
AA seq 372 aa AA seqDB search
MNNKTIALAVAVLAACLSLLLSTASPGLASPAGASAPAARSAAPTRPQQNCRAVTERTCA
VAHALGRGINLGNMLEAPREGDWGIRLEPGFIDIAARHFQTVRLPVRWTNHAAPTADATI
DEAFARRVDGVVDALLAKGVYVILNVHHYSQIHGDQPHQHEFTVDPALLETRLVNIWRQL
GQRYQNRSPRLLFELLNEPHGRLDGEPWNQLIPQALAAVRATNPERPVLVGPSYWNNVRD
LPKLRLPRDRNLIVAIHTYEPFNFTHQGVSWRPDLRTGQTCCDSRQRREMADPFEKAERW
NREQGYPLHLGEFGAHSAGEMGSRAEYTRLVRDEAERRGIGWTYWEFGSEFAGVWSPETR
GWVEPIRRALLD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaacaagaccatcgcgctggccgtcgccgtcctggccgcctgcctgtcgctgctg
ctgtccaccgcctcgcccggcctggcttcgcctgccggcgcttccgcgcccgcagcccga
tcggctgcgccgacccggccgcaacagaactgccgggcggtgaccgagcgcacctgcgcc
gtggcccatgcgctgggacgcggcatcaacctcggcaacatgctcgaggcgccgcgcgag
ggcgactggggcatccgcctggagcccggcttcatcgacatcgccgcccgtcatttccag
accgtgcgcctgccggtgcgctggaccaaccatgccgcgccgaccgcggatgccaccatc
gatgaggcgttcgcgcggcgcgtggacggtgtggtggacgcgctgctggccaagggcgtg
tacgtgatcctcaacgtgcaccactacagccagatccacggcgaccagccgcaccaacac
gagttcaccgtggatccggcgctgctggagacacggctggtcaacatctggcggcagctg
ggccagcgttaccagaaccgctcgccgcgcctgctgttcgagctgctcaacgagccgcac
ggccgtctcgacggcgagccctggaaccagctcatcccccaggcgctggcggcggtgcgg
gccaccaatccggaacggccggtgctggtggggcccagctactggaacaacgtgcgcgac
ctgcccaagctgcggctgccgcgcgaccgcaacctgatcgtggccatccacacctacgag
cccttcaacttcacgcaccagggcgtgtcctggcgcccggatttgcgcaccggccagacc
tgctgcgacagccgccagcggcgcgagatggccgaccccttcgaaaaggccgagcgctgg
aaccgcgagcagggctacccgttgcacctgggcgagttcggcgcgcacagcgccggcgaa
atgggttcgcgggcggaatacacccgcctggtgcgcgacgaggccgagcggcgcggcatc
ggctggacgtactgggagttcggctccgaattcgccggcgtgtggtcgcccgagacgcgc
ggctgggtcgagccgatccgccgggcgctgctggactaa

DBGET integrated database retrieval system