KEGG   Ramlibacter tataouinensis: Rta_10430Help
Entry
Rta_10430         CDS       T01544                                 

Definition
acetyl-CoA synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rta01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rta00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rta00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rta00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rta00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081457..1083268
Genome map
AA seq 603 aa AA seqDB search
MAPSQNRDNHAALHASFRWQVPQRFNIAQACCTRWARSPGASRRIAVRAHSERGVPAVLS
YSELQAQADAVSRALRALGVQRGDRVAIVMPQRFETAVAYMAVFQLGAVAMPLSMLFGPE
ALEFRLCDSGAVVAICDDSSMANIAQVRERCPALRTVAGVGAAAAQCDADWLDWMRDRSG
AFDPVDTAADEAAVLIYTSGTTGPPKGALIPHRALIGNLPGFVCSQNWFGFDPARGGDSQ
AVFWSPADWAWTGGLMDALLPSLYFGRPIVAFNGRFSPELAFTLMQQHGVTHTFLFPTAL
KAMMKAFPRPRERFPLRLQAVMSAGEAVGDAVFAYCREQLGVTVNEMFGQTEINYVVGNC
SMEWAPTLPASRGSLPPEGAQPALGRPGGGLTAGRAVVGWPARPGSMGRPYPGHRVAVID
DAGNECPPGEPGDVAVHRCDVHGDLDPIFFLGYWNQEDATRRKFTGDWCRTGDLAVRDED
GYLWYQGRADDVFKAAGYRIGPGEIENCLVKHPAVANAAVVPKPDRERGAVVKAYVVLAP
GHAGGDSLVAELQQHVKGKLAPYEYPKEIEFIEQLPMTTTGKVQRRVLRLQEEERARAQA
AQP
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagtcaaaaccgggacaaccacgcggccctgcacgcgtcgttccgctggcag
gttccgcagcgcttcaacatcgcccaggcgtgctgcacgcgctgggcgcgctcgcccggc
gcttcgcgcaggatcgccgtgcgcgcccattcggagcggggcgtgcccgctgttctctcg
tattccgagctgcaggcgcaggccgacgccgtcagccgggccctgcgcgcgctgggcgtg
cagcgcggtgaccgggtcgccatcgtgatgccgcagcgtttcgagaccgccgtcgcctac
atggcggtgttccagctgggggcggtggccatgccgctgtccatgctgttcggccccgag
gcgctggagttccggctgtgcgacagcggggccgtggtggccatctgcgacgacagctcg
atggccaacatcgcgcaggtgcgcgagcgctgcccggcgctgcgcaccgtggcgggcgtg
ggcgcggccgccgcgcaatgcgatgccgattggctggactggatgcgcgaccggtccggc
gccttcgatcctgtcgacacggcggccgacgaggccgccgtgctgatctacaccagcggc
accaccggcccgcccaagggcgcgctgatcccgcaccgcgccctgatcggcaacctgccg
gggttcgtctgcagccagaactggttcggcttcgacccggcgcgcggcggcgactcgcag
gccgtgttctggtccccggcggactgggcgtggacgggcggcctcatggatgctttgttg
cccagcctgtacttcggccggcccatcgttgccttcaacggccgcttcagcccggagctg
gcgttcaccctgatgcagcagcacggcgtgacgcacaccttcctgttccccaccgcgctc
aaggccatgatgaaggccttcccgcggccgcgcgagcgcttcccgctgcggctgcaggcc
gtcatgagcgcgggcgaggcggtgggcgacgcggtgttcgcctattgccgcgagcagctg
ggcgtcaccgtgaacgagatgttcggccagaccgagatcaactacgtggtcggcaactgc
tccatggaatgggcccccacgctccccgcttcgcgtggttcgctgccccccgagggggcc
caacccgccttggggcggcccggcggcgggttgacggccggccgtgccgtggtgggctgg
ccggccaggccgggcagcatgggccgcccgtacccggggcatcgtgtcgcggtcatcgac
gatgcaggcaacgaatgcccgcccggcgagccgggcgacgtggcggtgcaccgctgcgac
gtgcacggcgaccttgaccccatcttcttcctgggctactggaaccaggaggacgccacc
cgccgcaagttcaccggcgactggtgccgcaccggcgacctggcggtgcgcgacgaggac
ggctacctctggtaccagggccgcgccgacgacgtgttcaaggcggcgggctaccgcatc
ggccccggcgagatcgagaactgcctggtcaagcatccggcggtggccaatgccgccgtg
gtgcccaagccggaccgcgagcgcggcgcggtggtcaaggcctatgtggtgctggcgccc
ggccacgccggcggcgactcgctggtggccgagttgcagcagcacgtcaagggcaagctc
gcgccctacgagtaccccaaggagatcgagttcatcgagcagctgcccatgaccaccacc
ggcaaggtgcagcggcgggtgctgcggctgcaggaggaggaacgcgcccgggcgcaggcc
gctcagccgtag

DBGET integrated database retrieval system