KEGG   Ramlibacter tataouinensis: Rta_10430Help
Entry
Rta_10430         CDS       T01544                                 

Definition
acetyl-CoA synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rta_10430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rta_10430
   00620 Pyruvate metabolism
    Rta_10430
   00640 Propanoate metabolism
    Rta_10430
  Energy metabolism
   00680 Methane metabolism
    Rta_10430
Enzymes [BR:rta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rta_10430
Lipid biosynthesis proteins [BR:rta01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rta_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081457..1083268
Genome map
AA seq 603 aa AA seqDB search
MAPSQNRDNHAALHASFRWQVPQRFNIAQACCTRWARSPGASRRIAVRAHSERGVPAVLS
YSELQAQADAVSRALRALGVQRGDRVAIVMPQRFETAVAYMAVFQLGAVAMPLSMLFGPE
ALEFRLCDSGAVVAICDDSSMANIAQVRERCPALRTVAGVGAAAAQCDADWLDWMRDRSG
AFDPVDTAADEAAVLIYTSGTTGPPKGALIPHRALIGNLPGFVCSQNWFGFDPARGGDSQ
AVFWSPADWAWTGGLMDALLPSLYFGRPIVAFNGRFSPELAFTLMQQHGVTHTFLFPTAL
KAMMKAFPRPRERFPLRLQAVMSAGEAVGDAVFAYCREQLGVTVNEMFGQTEINYVVGNC
SMEWAPTLPASRGSLPPEGAQPALGRPGGGLTAGRAVVGWPARPGSMGRPYPGHRVAVID
DAGNECPPGEPGDVAVHRCDVHGDLDPIFFLGYWNQEDATRRKFTGDWCRTGDLAVRDED
GYLWYQGRADDVFKAAGYRIGPGEIENCLVKHPAVANAAVVPKPDRERGAVVKAYVVLAP
GHAGGDSLVAELQQHVKGKLAPYEYPKEIEFIEQLPMTTTGKVQRRVLRLQEEERARAQA
AQP
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagtcaaaaccgggacaaccacgcggccctgcacgcgtcgttccgctggcag
gttccgcagcgcttcaacatcgcccaggcgtgctgcacgcgctgggcgcgctcgcccggc
gcttcgcgcaggatcgccgtgcgcgcccattcggagcggggcgtgcccgctgttctctcg
tattccgagctgcaggcgcaggccgacgccgtcagccgggccctgcgcgcgctgggcgtg
cagcgcggtgaccgggtcgccatcgtgatgccgcagcgtttcgagaccgccgtcgcctac
atggcggtgttccagctgggggcggtggccatgccgctgtccatgctgttcggccccgag
gcgctggagttccggctgtgcgacagcggggccgtggtggccatctgcgacgacagctcg
atggccaacatcgcgcaggtgcgcgagcgctgcccggcgctgcgcaccgtggcgggcgtg
ggcgcggccgccgcgcaatgcgatgccgattggctggactggatgcgcgaccggtccggc
gccttcgatcctgtcgacacggcggccgacgaggccgccgtgctgatctacaccagcggc
accaccggcccgcccaagggcgcgctgatcccgcaccgcgccctgatcggcaacctgccg
gggttcgtctgcagccagaactggttcggcttcgacccggcgcgcggcggcgactcgcag
gccgtgttctggtccccggcggactgggcgtggacgggcggcctcatggatgctttgttg
cccagcctgtacttcggccggcccatcgttgccttcaacggccgcttcagcccggagctg
gcgttcaccctgatgcagcagcacggcgtgacgcacaccttcctgttccccaccgcgctc
aaggccatgatgaaggccttcccgcggccgcgcgagcgcttcccgctgcggctgcaggcc
gtcatgagcgcgggcgaggcggtgggcgacgcggtgttcgcctattgccgcgagcagctg
ggcgtcaccgtgaacgagatgttcggccagaccgagatcaactacgtggtcggcaactgc
tccatggaatgggcccccacgctccccgcttcgcgtggttcgctgccccccgagggggcc
caacccgccttggggcggcccggcggcgggttgacggccggccgtgccgtggtgggctgg
ccggccaggccgggcagcatgggccgcccgtacccggggcatcgtgtcgcggtcatcgac
gatgcaggcaacgaatgcccgcccggcgagccgggcgacgtggcggtgcaccgctgcgac
gtgcacggcgaccttgaccccatcttcttcctgggctactggaaccaggaggacgccacc
cgccgcaagttcaccggcgactggtgccgcaccggcgacctggcggtgcgcgacgaggac
ggctacctctggtaccagggccgcgccgacgacgtgttcaaggcggcgggctaccgcatc
ggccccggcgagatcgagaactgcctggtcaagcatccggcggtggccaatgccgccgtg
gtgcccaagccggaccgcgagcgcggcgcggtggtcaaggcctatgtggtgctggcgccc
ggccacgccggcggcgactcgctggtggccgagttgcagcagcacgtcaagggcaagctc
gcgccctacgagtaccccaaggagatcgagttcatcgagcagctgcccatgaccaccacc
ggcaaggtgcagcggcgggtgctgcggctgcaggaggaggaacgcgcccgggcgcaggcc
gctcagccgtag

DBGET integrated database retrieval system