KEGG   Ramlibacter tataouinensis: Rta_14480Help
Entry
Rta_14480         CDS       T01544                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rta  Ramlibacter tataouinensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rta_14480 (folA)
   00670 One carbon pool by folate
    Rta_14480 (folA)
Enzymes [BR:rta01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Rta_14480 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1515493..1515984)
Genome map
AA seq 163 aa AA seqDB search
MKLGLIFARAANGVIGRHGGLPWHLPEDLAHFKQVTLGCPVIMGRKTWDSLPPRFRPLPG
RRNIVVTRQPGWQAEGAQRAGSLREALALCEGQRQAWVIGGAELYRLALPHAQVVEATEI
GAEYDGDAYAPDLGPAWLEVARERHQSPAGLPFDFVTYHRAVP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgggcctgatcttcgcccgcgcggccaacggcgtgatcggcaggcacggcggc
ctgccctggcacctgcccgaggacctggcgcacttcaagcaggtgacgctgggctgcccc
gtgatcatgggccgcaagacctgggactcgctgccgccgaggttccgccccctgcccggc
cggcgcaacatcgtggtcacccgtcagcctggatggcaggccgagggcgcgcagcgggcg
ggctcgctgcgggaggcgctggcgctgtgcgaggggcagcggcaggcctgggtcatcggc
ggtgccgagctgtaccgcttggcgctgccgcacgcccaggtggtggaggccaccgagatc
ggcgccgagtacgacggcgatgcctacgcacccgacctgggtcccgcctggctggaggtc
gcgcgcgagcgccaccagtcgccggccggcctgcccttcgacttcgtgacctaccaccgg
gccgtgccgtga

DBGET integrated database retrieval system