KEGG   Ramlibacter tataouinensis: Rta_15940Help
Entry
Rta_15940         CDS       T01544                                 

Gene name
acsA
Definition
(GenBank) candidate acetyl-coenzyme A synthetase(Acetate--CoA ligase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00010  Glycolysis / Gluconeogenesis
rta00620  Pyruvate metabolism
rta00640  Propanoate metabolism
rta00680  Methane metabolism
rta01100  Metabolic pathways
rta01110  Biosynthesis of secondary metabolites
rta01120  Microbial metabolism in diverse environments
rta01130  Biosynthesis of antibiotics
rta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rta_15940 (acsA)
   00620 Pyruvate metabolism
    Rta_15940 (acsA)
   00640 Propanoate metabolism
    Rta_15940 (acsA)
  Energy metabolism
   00680 Methane metabolism
    Rta_15940 (acsA)
Enzymes [BR:rta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rta_15940 (acsA)
Lipid biosynthesis proteins [BR:rta01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rta_15940 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEG92685
UniProt: F5Y5I9
Position
1675911..1677896
Genome map
AA seq 661 aa AA seqDB search
MSAIESVLVENRVFPPQEAAVKAARISGMAAYEALCRQAEQDFQGFWAQQARDNVVWTRP
FSRTLDESNAPFYKWFDDGELNASANCLDKHVGTPVENETAIVFEADDGTVTRVTYKELL
ARVGQFANALKAQGIRKGDRVIIYMPMTVEGVVAMQACARIGATHSVVFGGFSAKALNER
IIDAGAVAVITANFQMRGGKELPLKAIVDDAIAMGGCTTLRTVLVYMRTPTACNMAAGRD
KTFDEVLKGQSAECTPVSVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAKLTMDWTFD
IQPKDVFWCTADIGWITGHTYVAYGPLAAGATQVIFEGIPTWPDAGRFWQMIQKHKVTVF
YTAPTAIRSLIKAAETDAKVHPRNWDLSSLRILGSVGEPINPEAWMWYHKNVGGERCPIV
DTFWQTETGGHVITPLPGATPTVPGSCTLPLPGIMAAIVDETGKDLPNGAGGMLVIKRPW
PSMIRTIWGDPERFKKSYFPEEMGGRTYLAGDGAVRSSDRGYFRITGRIDDVLNVSGHRL
GTMEIESALVSKTDLVAEAAVVGRPDDLTGEAVCAFVVLKRPRPVGEEAKKIANELRNWV
AKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKGEAITQDTSTLENPAILEQLAEK
N
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccatcgaatcggtcctggtcgaaaaccgcgtcttcccgccgcaggaggccgcc
gtgaaggcggcgcgcatctccggcatggccgcgtacgaggccctgtgccggcaggccgag
caggacttccagggcttctgggcccagcaggcccgcgacaacgtcgtctggacgcggccc
ttttcccgcacgctggacgagtcgaacgcgccgttctacaagtggttcgacgacggcgag
ctcaacgccagcgccaactgcctggacaagcacgtgggcacgccggtggagaacgaaacc
gccatcgtgttcgaggccgacgacggcacggtgacccgggtcacctacaaggaactgctg
gcgcgggtcggccagttcgccaacgcgctcaaggcccagggcatccgcaagggcgaccgg
gtcatcatctacatgcccatgaccgtcgagggtgtggtggcgatgcaggcctgcgcccgc
atcggcgccacgcacagcgtggtgttcggcggcttctcggccaaggcgctgaacgagcgc
atcatcgacgccggcgcggtggcggtcatcaccgccaacttccagatgcgcggcggcaag
gaattgccgctcaaggccatcgtggacgacgccatcgccatgggtggctgcaccacgctg
cggaccgtgctggtctacatgcgcacgcccactgcctgcaacatggcggccggccgcgac
aagaccttcgatgaggtgctcaagggccagagcgccgagtgcacgccggtgagcgtgggc
gccgagcacccgctgttcatcctctacacctcgggctccaccggcaagcccaagggcgtg
cagcactccaccggcggctacctgctgtgggccaagctcaccatggactggactttcgac
atccagcccaaggacgtgttctggtgcaccgccgacatcggctggatcaccggccacacc
tacgtggcctacggcccgctggccgcaggcgccacccaggtcatcttcgagggcatcccg
acctggccggacgccgggcgcttctggcagatgatccagaagcacaaggtgacggtgttc
tacacggcgccgacggccatccgctcgctgatcaaggccgccgagaccgacgccaaggtg
cacccgcgcaactgggacctgtcgtcgctgcgcatcctgggcagcgtgggcgagcccatc
aatcccgaggcctggatgtggtaccacaagaacgtgggcggcgagcgctgccccatcgtg
gacaccttctggcagaccgagaccggcggccacgtgatcacgccgctgccgggcgccacg
cccaccgtgccgggctcctgcacgctgccgctgccgggcatcatggccgccatcgtcgac
gagaccggcaaggacctgcccaacggcgccggcggcatgttggtgatcaagcggccctgg
ccctccatgatccgcaccatctggggtgacccggagcgtttcaagaagagctacttcccc
gaggagatgggcggcaggacctacctggccggcgacggcgcggtgcggagcagcgaccgc
gggtacttccgcatcaccggccgcatcgacgacgtgctcaacgtctccggccaccgcctg
ggcaccatggagatcgagtcggcgctggtgtccaagaccgacctggtggccgaggccgcg
gtggtgggccggcccgacgacctgaccggcgaggcggtctgcgccttcgtggtgctcaag
cgcccgcgccccgtgggcgaggaggccaagaagatcgccaacgagctgcgcaactgggtg
gccaaggagatcggccccatcgccaagcccaaggacatccgcttcggcgacaacctgccc
aagacccgcagcggcaagatcatgcggcgcctgctgcgcagcatcgccaagggcgaggcg
atcacgcaggacacgtcgactctcgagaacccggccatcctcgagcagctggccgagaag
aactga

DBGET integrated database retrieval system