KEGG   Ramlibacter tataouinensis: Rta_16180Help
Entry
Rta_16180         CDS       T01544                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rta  Ramlibacter tataouinensis
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rta00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:rta00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702939..1704423
Genome map
AA seq 494 aa AA seqDB search
MMTTLNAQATMTWWTRGTAWLRPGAAPQGLAAVHPAMAAPAPSKEPAPRMRPLRERLEAT
LGRTHEALSPRMLRRILAELQAITDSRISEVEAGRRAHAVAQWYAQATPQERRDCWLLMT
EKFAPDAARLRSAREHYERAVGSPGEGQAEIQLRRAMVSPRSRLLQRFAAYPQGMRFLVD
LRAELLPQLKGDPRLLPLDAELEHLFSTWFDVGFLELRRISWDSPASLIEKLIRYEAVHD
IRSWADVKNRLDSDRRCYGFFHPRLEDEPLIFVEVALVHELAGCITPLLDEAAAVSDPHK
ASTAIFYSISNTQTGLRGVSFGDSLIKRVVETLAGEFPRLKTFATLSPIPGLRPWVNRHA
GALLQQLDAKKRAELARVLGAEPQAANVLAALEQPLGLDARSPLRALLLGWCAQYLGREL
QDGRPLDAVARFHLGNGARIERLNWAGDPSSKGLKQSFGLMVNYLYDLKRLDRHRGLLGR
GQIPMSKAVEELYL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaccctcaacgcgcaagcaaccatgacctggtggacccggggcacggcctgg
ctgcggccgggcgccgcgccgcagggcctggcggcggtccaccccgccatggccgcgccg
gcgccttccaaggagccggccccgcgcatgcgcccgctgcgcgagcggctggaggccacc
ctgggccgcacgcacgaggccttgtcgccgcgcatgctgcggcgcatcctggccgagctg
caggccatcaccgacagccgcatcagcgaggtcgaggccggccggcgtgcccatgcggtc
gcgcagtggtacgcccaggccacgccgcaggagcggcgcgactgctggctgctgatgacc
gagaagttcgcgcccgacgccgcgcgcctgcgcagcgcccgcgagcattacgagcgggcg
gtgggctcgcccggcgaaggccaggccgagatccagctgcgccgcgccatggtgtcgccg
cgctcgcgcctgctgcagcgtttcgccgcctacccgcagggcatgcgtttcctggtggac
ctgcgcgccgagctgctgccgcagctcaagggcgacccgcggctgctgccgctggacgcc
gagctggagcacctgttttccacctggttcgacgtgggcttcctagagctgcggcgcatc
agctgggactcgccggcctcgctgatcgaaaagctcatccgctacgaggcggtgcacgac
atccgcagctgggccgacgtgaagaaccgcctggacagcgaccggcgctgctacggcttc
ttccacccgcggctggaggacgagccgctgatcttcgtcgaggtggccctggtccacgag
ctggccggctgcatcaccccgctgctggacgaggcggccgccgtctccgacccgcacaag
gccagcaccgccatcttctattccatcagcaacacccagaccgggctgcgcggcgtgagc
ttcggcgattcgctgatcaagcgggtggtggagacgctggccggggagttcccgcggctc
aagaccttcgccacgctctcgcccatccccggcctgcgcccctgggtgaaccggcatgcc
ggtgcgctgctgcagcagctcgatgcgaagaagcgggcggagctggcgcgcgtgctgggc
gccgagccgcaggccgccaacgtgctggccgccctggagcagccgctagggctggacgcc
cgctcgccgctgcgggcgctgctgctgggctggtgcgcccagtacctggggcgcgagctg
caggatggccggccgctggacgcggtggcccgtttccacctgggcaacggcgcccggatc
gagcggctcaactgggcgggcgatccgtcttccaaaggtctgaagcagtcgttcggcctg
atggtcaactacctgtacgacctgaagcggctggaccggcaccgcggcctgctgggtcga
ggacaaatcccgatgtcgaaggcggtggaagagctgtatctttga

DBGET integrated database retrieval system