KEGG   Ramlibacter tataouinensis: Rta_17200Help
Entry
Rta_17200         CDS       T01544                                 

Gene name
phoD
Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rta00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rta00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rta02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805367..1806959
Genome map
AA seq 530 aa AA seqDB search
MVEPVLAERRRLLQLAAAAAACTWLPRGAHAQRRWGFDPFSLGVASGSPAADSVVLWTRL
LGPGWWDSIGEAPVPVRWEVAHDQGFSRIARRGETLALAQLGHSVHAEVAGLEPDRWYFY
RFTAGHAVSPTGRTRTLPAADALPARLRLAYASCQRWEHGYYGAYRHMREEQLDLVMFLG
DYIYEYPNATAAVRDFPTLGWVHTLQEYRERHALHRGDVHLQAMHAACPWLVSWDDHEVQ
NDYAAGQAGDGRPLGLNASSDFAARRAAAYQAYYEHMPLRASALGGALAGVAGAADVRLY
GRWRFGRLADLLLLDTRQYRDRQVCGPDFKPSGQVHPSACPAWEDPGRSLLGAAQEQWLD
TAFAQAGSGWTVVGQQTLFGRRDNHPGAGEQFWNDGWDGYGAARRRVTGSLQRHQVVNPV
FLGGDVHENWVGHVKADYARQGSASLGVEFCGTSITSRAGGAEQVAQRLAENPHYVFADG
WRRGYSVCEFTPQRLTTTLRVLDDATREDARIETQARFTVQAGRPRLERA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaacccgtccttgccgagcgtcgacggctgctccagctggcggccgcagccgcc
gcctgcacctggctgccgcgcggcgcccacgcgcagcgccgctgggggttcgatcctttt
tcgctgggggtcgcgagcggctcgcccgccgcggactccgtggtgctgtggacccggctg
ctggggccgggctggtgggacagcatcggcgaagcgccggtgccggtgcgctgggaggtg
gcccacgaccagggcttctcgcgcatcgcccgccgcggcgaaaccctggcgctggcgcag
ctggggcacagcgtccatgccgaggtggccggcctggaaccggatcgctggtacttctac
cgcttcaccgccggccatgcggtgagccccaccggccgcacgcgcacgctgccggcggcc
gacgcgctgccggcgcgcctgcgcctggcgtatgcctcgtgccagcgctgggagcacggc
tactacggcgcctaccgccacatgcgcgaggagcagctggacctggtgatgttcctgggc
gactacatctacgagtatcccaacgccaccgccgccgtgcgcgactttccgaccctgggc
tgggtgcacaccctgcaggagtaccgcgagcgccatgcgctgcaccgcggcgacgtgcac
ctgcaggccatgcacgccgcctgtccctggctggtgagctgggatgaccatgaggtgcag
aacgactatgcggccggccaggccggcgacggccggcccctgggcctgaacgcctcgtcc
gatttcgcggcccggcgcgcagccgcctaccaggcgtactacgagcacatgccgctgcgc
gcgtcggcgctgggcggcgccctggcaggcgtggccggtgcagccgatgtgcggttgtat
ggccgttggcgtttcggccggctggccgatctgctgctgctggacacgcgccagtaccgc
gaccgccaggtctgcggtccggacttcaagccttccgggcaggtccatccctcggcctgc
ccggcgtgggaggacccggggcgcagcctgctgggcgccgcgcaggagcaatggctggac
accgccttcgcgcaggcgggcagcggctggaccgtggtcgggcagcagaccctgttcggc
cgccgcgacaaccatcccggggcgggcgagcagttctggaacgacggctgggacggctat
ggcgcggcgcggcgccgcgtgaccggatcgctgcagcgccatcaggtggtcaacccggtt
ttcctgggcggcgacgtgcacgagaactgggtgggccatgtcaaggccgactacgcccgg
cagggcagcgccagcctgggcgtggagttctgcggcaccagcatcacctcgcgcgcgggc
ggcgccgagcaggtggcccagcggctggcggagaacccgcactacgtcttcgccgatggc
tggcgccggggctacagcgtgtgcgagttcacgccgcagcggctgaccacgacgctgcgg
gtgctggacgacgccacccgcgaggatgcccgcatcgagacgcaagcccgcttcaccgtg
caggccggacggccgcggctggaacgcgcctga

DBGET integrated database retrieval system