KEGG   Ramlibacter tataouinensis: Rta_17490Help
Entry
Rta_17490         CDS       T01544                                 

Definition
1-deoxyxylulose-5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rta  Ramlibacter tataouinensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rta_17490
Enzymes [BR:rta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rta_17490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1837861..1839051
Genome map
AA seq 396 aa AA seqDB search
MDKQRIAVLGSTGSVGASTLDVVARHPDRFEVFALCAATRVDEMLAQCRRFRPQVAVMAD
EAAGRELARQLEAHGLPTRVEVGPSAVDAVASHEAVHIVMAAIVGAAGLSSCLAAARAGK
RLLLANKEALVVGGEVFLAAVREGGATLLPIDSEHSAIFQSLPEDPASWDERVEKIILTA
SGGPFRTRDPASLRQVTPEEACAHPNWVMGRKISVDSATMMNKALEVIEARYLFGLPPER
LEVVIHPQSVIHSMVQYRDSSVVAQLGTPDMRVPIAYGLAWPGRVASGAQALDFSRLADM
SFEAVDSRGHRDRFPGLQLAWDCLRAPAGTTAVLNAANEVAVAAFLDRRIRFDQIHALNL
ATLEAVPVSKPRALGDLLELDGRARRSAEAGIARLP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcaacgcatcgccgtcctgggctcgaccggctcggtcggcgccagcacgctg
gacgtggtggcgcgccacccggaccgcttcgaggtgttcgccctgtgcgccgccacccgg
gtggacgagatgctggcgcagtgccggcgcttccggccgcaggtcgcggtgatggccgac
gaggctgcgggccgcgagctggcgcgccagctggaggcccatggccttcccacccgcgtc
gaggtggggccgtcggcggtcgacgctgtcgcctcgcacgaggcggtccacatcgtgatg
gccgccatcgtcggtgccgccgggctgtcgtcctgcctggccgccgcccgcgccggcaag
cgcctgctgctggccaacaaggaggcgctggtggtaggcggcgaggtcttcctggcggcc
gtgcgcgagggcggcgccacgctgctgccgatcgacagcgagcattcggcgatcttccag
tcgctgcccgaggacccggcgagctgggacgaacgcgtcgagaagatcatcctcaccgcc
tcgggcggcccgttccgcacgcgcgaccccgccagcctgcggcaggtcacgcccgaggag
gcctgcgcccacccgaactgggtgatgggccgcaagatctcggtggactccgccaccatg
atgaacaaggcgctggaggtgatcgaggcgcgctacctgttcgggctgccgcccgagcgg
ctggaggtggtgatccatccgcaaagcgtgatccactccatggtgcagtaccgggacagc
tcggtggtggcccagcttgggacgccggacatgcgggtgcccatcgcctacggcctggct
tggccgggacgggtggcctcgggcgcccaggcgctggatttctcgcgcctggcggacatg
agcttcgaagcggtcgacagccgcggccaccgcgaccgcttcccgggactgcagctggcc
tgggactgcctgcgggcgccggccggcaccacggcggtgctcaatgccgccaacgaggtg
gcggtggcggcctttctggaccggcgtatccgtttcgaccagatccatgcgctcaacctt
gcaactttggaggccgtgccggtctccaagccgcgggcgctgggcgacttgctggagctg
gacggccgtgcccgccgctccgccgaagccgggatcgcgcggctgccctga

DBGET integrated database retrieval system