KEGG   Ramlibacter tataouinensis: Rta_17740Help
Entry
Rta_17740         CDS       T01544                                 

Gene name
folP
Definition
dihydropteroate pyrophosphorylase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rta  Ramlibacter tataouinensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rta_17740 (folP)
Enzymes [BR:rta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rta_17740 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1866330..1867214
Genome map
AA seq 294 aa AA seqDB search
MAQNQPMHWQTTRHRIDLATPRVMGIVNLTPDSFSDGGRHAGTRPALAHCEELVAQGAHI
LDLGAESSRPGTAPVSLEEERARLLPVLREALSLGVPVSVDTYKPALMREVLDLGADIVN
DIWALRQPGAREAVAAHPSCGVCLMHMHGEPRTMQRVPMEGDAVPQVLAFLQEQTAALGR
LGVDKARVVWDAGIGFGKTVEQNFALLARQHELLAGGHPLLAGWSRKSSLGAVTGLAVHE
RLAPSVAAALLAVERGARIVRVHDVRETAAALQVWNSTISAVLPAQGRAGRSNP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcagaatcaaccgatgcactggcagaccacacgccaccggatcgacctggccacg
ccccgggtgatgggcatcgtcaacctcacgcccgattcgttctcggacggcgggcgccac
gccggcacccgcccggccctggcccattgcgaggaactggtcgcccagggcgcccacatc
ctggacctgggcgccgagtccagccgccccggcaccgcgcccgtgtccctggaggaggag
cgcgcccggctgctgccggtgctgcgcgaggcgctgtcgctgggcgtgccggtttcggtc
gacacctacaagccggcgctgatgcgcgaggtgctggacctgggggcggacatcgtcaac
gacatctgggcgctgcgccagcccggtgcgcgcgaggcggtggcggcccacccgtcctgc
ggcgtgtgcctgatgcacatgcacggcgagccgcggaccatgcagcgtgtcccgatggaa
ggcgacgccgtgccgcaggttctggcgttcctgcaggagcagaccgcggcgctgggccgg
ctgggcgtggacaaggcgcgcgtcgtgtgggatgcgggcataggcttcggcaagaccgtg
gagcagaacttcgcgctgctggcgcgccagcacgagctgctggccggcggccatccgctg
ctggcggggtggtcgcgcaagtcatcgctgggcgccgtcaccggcctggcggtgcacgag
cgcctggcgcccagcgtcgcggcggcgctgctggcggtggagcgcggcgcccgcatcgtg
cgggtgcatgacgtcagggaaacagcggccgcgctgcaggtatggaactctacaatttcg
gctgttttgccggcacaaggccgggcagggaggagcaatccatga

DBGET integrated database retrieval system