KEGG   Ramlibacter tataouinensis: Rta_18800Help
Entry
Rta_18800         CDS       T01544                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rta  Ramlibacter tataouinensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rta_18800 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rta_18800 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Rta_18800 (sucB)
Enzymes [BR:rta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rta_18800 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981811..1983094
Genome map
AA seq 427 aa AA seqDB search
MAIVDVKVPQLSESVAEATLLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAEV
AVANGGTVTADQVIARIDSEGRAGATAPAAAPAAAAAGKPDAATPSAVASQPAAVAGAKA
GVAMPAAAKLMADNNLPAGSVAGSGRDGRVTKGDVLGAVAGGTPKLAVVPAQPARPAAPS
LPQVAAPVAAPDLGERPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMEMRK
RFQEKFEKEHGVKIGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRG
LVVPILRNADQMSFADIEKKIAEFGQKAKDGKLGIEEMTGGTFSISNGGVFGSMLSTPII
NPPQSAILGVHATKERPVVENGQIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDP
ARLLFDI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgacgtgaaagtgccgcagctgtcggagtcggtggcggaagcaaccctg
ctgcagtggaagaagaagcccggcgaggccgtggcccaggacgagatcctgatcgagatc
gagaccgacaaggtggtgctcgaggtgccggcccccagcgccggcgtgctggccgaggtg
gccgtggccaatggcgggaccgtgacggccgaccaggtcatcgccaggatcgacagcgag
ggcagggccggtgccaccgcacccgcggccgcgccggccgctgcggccgcgggcaagccc
gacgccgcaacccccagcgctgtggcctcccagccagcggccgtggcgggcgccaaggcc
ggcgtggccatgcccgcggcggccaagctgatggccgacaacaacctgcccgccggctcg
gtggccggcagcggccgcgatggccgcgtgaccaagggtgacgtgctgggcgcggtggcc
ggcggcactcccaaactggcggtcgtgccggcgcaaccggcgcggccggcggcgccgtcg
ctgccgcaggtggcggcacccgtcgcggcgcccgacctgggcgagcgtcccgagcagcgg
gtgcccatgagccggctgcgcgcccgcgtcgccgagcgcctgctgcagtcgcagtccacc
aatgccatcctgaccaccttcaacgaggtcaacatggcgccggtgatggagatgcgcaag
cgtttccaggagaagttcgagaaggagcacggcgtcaagatcggcttcatgagcttcttc
gtgaaggccgcggtgcacgcgctcaagaagtacccggtgatcaacgccagcgtggacggc
aacgacatcgtctaccacggctacttcgacatcggcatcgccgtcggctcgccgcgcggc
ctggtggtgcccatcctgcgcaatgccgaccagatgtcgttcgccgacatcgagaagaag
atcgccgagttcgggcagaaggccaaggacggcaagctgggcatcgaggagatgaccggc
ggcaccttctccatctccaacggcggcgtgttcggctccatgctgtccacccccatcatc
aacccgccgcaatcggccatcctgggcgtgcacgcgaccaaagagcgcccggtggtggag
aacggccagatcgtcatccgcccgatcaactacctggccatgagctacgaccaccgcatc
atcgacggccgcgaggccgtactgggcctggtggcgatgaaggaagcgctggaagacccg
gcccgtctcctcttcgacatctaa

DBGET integrated database retrieval system