KEGG   Ramlibacter tataouinensis: Rta_19160Help
Entry
Rta_19160         CDS       T01544                                 

Definition
Lysophospholipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rta  Ramlibacter tataouinensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rta_19160
Enzymes [BR:rta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rta_19160
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rta_19160
Lipid biosynthesis proteins [BR:rta01004]
 Fatty acid synthase
  Component type
   Rta_19160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2019086..2019715)
Genome map
AA seq 209 aa AA seqDB search
MDRRQLIAAGLAAAYAPAAWAATPVILVVGDSLSAEYGLKRGSGWVALLEQRLEREKIAA
RVVNASISGDTTSGGRSRLPALLAQHKPTHVVIELGGNDALRGLPLGMTENNLSAMTQAA
QKAGAEVLLAGIQLPPNYGRDYGERFAALFEKVGRQHKAAVVPFILKGVADIPDAARLFQ
PDRIHPTEEAQPQMLANVWPELVKLLRSK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttggatcgcaggcaattgatcgccgccggcctggccgcggcttacgctcccgccgcgtgg
gccgccacgccggtgattctggtcgtgggcgattccctgagtgccgagtatggcctcaaa
cgcggcagcggctgggtggcgctgctggagcagcggctggagcgcgagaagatcgcggcc
cgcgtggtcaatgccagcatcagcggcgacaccacctccggcggccgctcgcgcctgccg
gccctgctggcgcagcacaagccgacccacgtggtgatcgagctgggcggcaacgacgcg
ctgcgcggcctgcccctgggcatgacggagaacaacctgtcggccatgacgcaggcggcc
cagaaggccggcgccgaggtgctgctggccggcatccagctgccgcccaattacgggcgc
gactatggcgagcgcttcgcggcgctgttcgagaaggtgggccgccagcacaaggcggcg
gtggtgcccttcatcctcaagggcgtggccgacatccctgacgccgcccgcctgttccag
ccggaccgcatccatcccaccgaggaggcgcagccgcagatgctggccaacgtctggccc
gagctggtgaagctcctcaggtcgaagtga

DBGET integrated database retrieval system