KEGG   Ramlibacter tataouinensis: Rta_23280Help
Entry
Rta_23280         CDS       T01544                                 

Gene name
recR
Definition
recombinational DNA repair
Orthology
K06187  
recombination protein RecR
Organism
rta  Ramlibacter tataouinensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rta00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rta_23280 (recR)
DNA repair and recombination proteins [BR:rta03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rta_23280 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2471721..2472230)
Genome map
AA seq 169 aa AA seqDB search
MAFHLLQHDRQGAQLMAQALQQAVASVRHCSRCHTFTEDEVCEVCRNPQRDASKLCVVET
PADQAAVERTAAYRGLYFVLMGKLSPLDGIGPKDIGLAKLFERAADGQVQEVILATNFTA
EGEATAHVIGEALKARGLRVTRLARGVPAGSELEYVDLGTIAHALVDRR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggctttccacctgctgcagcacgaccgccagggcgcccagctgatggcccaggcgctg
cagcaggccgtggccagcgtgcgccactgcagccgctgccacaccttcaccgaggacgag
gtctgcgaggtctgccgcaatccgcagcgcgacgcgtccaagctgtgcgtggtggagacg
ccggccgaccaggccgcagtggagcgcaccgcggcctacaggggcctgtacttcgtgctc
atgggcaagctcagcccgctggacggcatcggccccaaggacatcggactggccaagctg
ttcgagcgcgccgccgacggccaggtgcaggaggtgatcctggccaccaacttcacggcc
gagggggaggccacggcgcacgtgatcggcgaggcgctcaaggcgcgcggcctgagggtg
acgcgcctggcgcgcggcgtgccggccggcagcgagctggagtacgtggacctgggcacg
atcgcgcacgcgctggtggaccggcgctag

DBGET integrated database retrieval system