KEGG   Ramlibacter tataouinensis: Rta_24010Help
Entry
Rta_24010         CDS       T01544                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rta_24010 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rta_24010 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rta_24010 (thrC)
Enzymes [BR:rta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rta_24010 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2550006..2551427)
Genome map
AA seq 473 aa AA seqDB search
MLYLSTRGHPERKRFSEILLEGLAPDGGLYLPERYPRVDAATLSRWRGLAYADLAFEILS
LYIDDIPADDLRAICRRTYTEEVFGTPQIVPLRKLEEGLYLQALSNGPTLAFKDMAMQLL
GQLFEYELGRRGEELNILGATSGDTGSAAEYAMRGKRGVRVFMTSPHGRMSPFQQAQMFS
LQDANIHNLAVQGVFDDCQDIVKAVSNDLAFKRRYRIGTVNSINWARLVAQVVYYFAGYF
QATGGNHEKVSFAVPSGNFGNICAGHVARMMSLPIARLVLATNENDVLDEFFRTGTYRVR
GSRDTYETSSPSMDISKASNFERFVFDLLGRDASRTRQLFGEQLPAQGRFELAGEVGAAR
ERYGFASGRSTHADRLATLRDTWQRHGVMIDTHTADGLKVAREHRQPGIPMVVLETALPI
KFAATVVEALGREPQRPARFEGIERLPKRVAVVPADAEAVKRYIAQHCDQAGA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctttacctctccacgcgcggccatcccgagcgcaagcgcttcagcgagatcctgctc
gagggcctggcgccggacggcggcctgtacctgcccgagcgctacccccgggtcgacgcc
gccacgctctcccgctggcgcgggctggcctatgcggacctggccttcgagatcctgtcg
ctgtacatcgacgacatccccgcggacgacctgcgcgcgatctgccgcaggacctacacc
gaggaggtgttcggcacgccgcagatcgtcccgctcagaaaactggaagaggggctgtac
ctccaggccctgtccaacggccccacgctggcgttcaaggacatggccatgcagctgctg
ggccagctgttcgagtacgagctgggacgccgcggcgaggagctcaacatcctgggcgcg
acctcgggcgacaccggcagcgccgccgagtacgccatgcgcggcaagcgcggcgtgcgc
gtgttcatgacctcgccgcatggccgcatgagcccgttccagcaggcgcagatgttcagc
ctgcaggacgccaacatccacaacctggcggtgcagggcgtgttcgacgactgccaggac
atcgtcaaggccgtgtcgaacgacctggcgttcaagcgcaggtacaggataggcaccgtc
aactccatcaactgggcgcggctggtggcgcaggtggtgtactacttcgcggggtatttc
caggcgaccggcgggaaccacgagaaggtcagcttcgccgtgccctccggcaacttcggc
aacatctgcgccggccacgtggcgcgcatgatgagcctgccgatcgcgcggctggtgctg
gcgaccaacgagaacgacgtgctggacgagttcttccgcaccggcacctaccgcgtgcgc
ggcagccgggacacctacgagacctccagcccatcgatggacatctccaaggccagcaac
ttcgagcgcttcgtgttcgacctgctggggcgcgatgcgtcccggacgcggcagctgttc
ggcgagcagctgccggcgcagggccgcttcgagctggccggcgaggtgggcgcggcgcgc
gagcgctacggcttcgccagcggcaggagcacccacgccgaccgcctggccaccctgcgc
gacacctggcagcgccatggcgtgatgatcgacacgcacacggccgacggcctgaaggtc
gcgcgcgagcaccgccagccgggcatcccgatggtggtgctggaaaccgcgctgccgatc
aagttcgccgccaccgtcgtcgaggcgctgggccgcgagccgcagcggccggcccgcttc
gagggcatcgagcggctgcccaagcgcgtggccgtggtgccggccgacgccgaggcggtc
aaacgctacatcgcgcagcattgcgaccaggcgggcgcatga

DBGET integrated database retrieval system