KEGG   Ramlibacter tataouinensis: Rta_24420Help
Entry
Rta_24420         CDS       T01544                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rta  Ramlibacter tataouinensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2592107..2592742)
Genome map
AA seq 211 aa AA seqDB search
MRARMVQRIAAQGVADAQVLAALGAVERHRFVDSALVNQAYEDTSLPIGLGQTISKPSVV
ARMVELLLGGARDAQGRLGRVLEIGTGCGYQAAVLSRVATEVYSIERLRGLHEKAQGNLR
PLRLANVHLLFGDGMAGFAKGAPYAGIIAAAGGEAVPAAWIEQLAPGGRIVAPSQMPGGT
QALVVLEKTAGGLQRSVLEAVHFVPLKSGIA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcccgcatggtgcagcgcatcgcggcgcagggcgtggccgacgcccaggtgctg
gcggcgctgggcgcggtggagcggcatcgcttcgtcgacagcgcgctggtgaaccaggct
tacgaggacaccagcttgcccatcggcctgggccagaccatttccaagcccagcgtggtg
gcgcgcatggtcgagctgctgctgggcggcgcccgggatgcgcagggacggctgggccgg
gtgctggagatcggcaccggctgcggctaccaggccgccgtgctcagccgtgtggccacc
gaggtctacagcatcgagcgcctgcgcggcctgcacgagaaggcgcagggcaacctgcgg
ccgctgcggctggccaacgtgcacctgctgttcggcgacggcatggcgggtttcgccaag
ggcgcaccgtatgcgggcatcatcgcggctgcggggggcgaggcggtgcccgcggcctgg
atcgagcagctcgcaccgggcgggcgcatcgtcgcgcccagccagatgcccgggggcacg
caggccctggtcgtgctcgaaaaaacggctgggggattgcagcgcagcgtgcttgaggcg
gttcacttcgtccccctaaaatcaggcatcgcatga

DBGET integrated database retrieval system