KEGG   Ramlibacter tataouinensis: Rta_24840Help
Entry
Rta_24840         CDS       T01544                                 

Gene name
rfbC
Definition
dTDP-L-rhamnose synthetase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rta  Ramlibacter tataouinensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rta_24840 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rta_24840 (rfbC)
Enzymes [BR:rta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rta_24840 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2635825..2636364
Genome map
AA seq 179 aa AA seqDB search
MKFTPTELAGAFIVDLERRQDERGWFARTYCANEFQAHGLPTHMVQTNMSLTRRAGTLRG
MHYQLAPHAEDKLVRCVRGAIWDAIVDIRPQSPTYCQWIGVELSEENGRALLVPQGFAHG
FVTLTDDAAVTYQVSAFYTPGAERGARHDDPAFGIRWPVAVQDLSDKDAAWPDFVKEAR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcacccccaccgagctggccggcgccttcatcgtcgatctggagcgccgccag
gacgagcgcggctggttcgcccgcacctactgcgccaacgaattccaggcacacggcctg
cccacccacatggtgcagaccaatatgtcgctgacccgccgcgccggcaccctgcgcggc
atgcactaccagctggccccccatgccgaggacaagctggtgcgctgcgttcgcggcgcc
atctgggacgccatcgtcgacatccgtccgcagtcgcccacctactgccaatggatcggc
gtggagctgagcgaggagaacggccgggcgctgctggtgccgcagggcttcgcccacggc
ttcgtgacgctgaccgacgacgcggccgtcacctaccaggtgtcggccttctacaccccg
ggtgccgagcgcggcgcgcgccacgacgatccggccttcggcatccgctggccggtggca
gtgcaggatctgtcggacaaggacgccgcatggcccgacttcgtgaaggaggcgcgatga

DBGET integrated database retrieval system