KEGG   Ramlibacter tataouinensis: Rta_26450Help
Entry
Rta_26450         CDS       T01544                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rta_26450
   01230 Biosynthesis of amino acids
    Rta_26450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rta_26450
   00051 Fructose and mannose metabolism
    Rta_26450
   00562 Inositol phosphate metabolism
    Rta_26450
Enzymes [BR:rta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rta_26450
Exosome [BR:rta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rta_26450
  Exosomal proteins of bladder cancer cells
   Rta_26450
  Exosomal proteins of melanoma cells
   Rta_26450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2814890..2815657)
Genome map
AA seq 255 aa AA seqDB search
MNMKKKKLIAGNWKMNGGIAANDALVRAVVAGMGADAGCQVAVCAPAPYLAQVQMLRHGS
ALELGAQDVSRHEQGAYTGEVSAAMLKEFGVRFAIVGHSERRQYHGESDALVADKAKAAL
AHGITPIVCVGETLAEREAGQTEAVVKRQLAAVIHANGHCISEIAVAYEPVWAIGTGRTA
TPGQAQQVHAVLRAQLQAATAHSDRVAILYGGSMNAANAASLLAQPDIDGGLIGGASLKA
ADFLQIIAAARAATA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatgaaaaagaaaaagctcatcgccggcaactggaagatgaacggcggcatcgcc
gccaacgacgcgctggtgcgcgccgtggtggcgggcatgggtgccgatgcgggctgccag
gtggcggtctgcgcgccggcgccctacctggcgcaggtgcagatgctgcgccacggctcg
gcgctcgagctcggcgcgcaggacgtctcgcgccacgagcagggcgcctacaccggcgag
gtgtcggccgccatgctcaaggagttcggcgtgcgtttcgccatcgtcgggcattccgag
cgccgccagtaccacggcgagagcgacgcgctggtggccgacaaggccaaggcggcgctc
gcgcacggcatcacgcccatcgtctgcgtcggcgagacgctggccgagcgcgaggccggc
cagaccgaggcggtggtcaagcgccagctggccgccgtgatccacgccaacgggcattgc
atcagcgagatcgcggtcgcctacgagccggtctgggccatcggcaccggccggaccgcc
acgcccgggcaggcccagcaggtgcatgccgtgctgcgcgcgcagctgcaggcggccacc
gcgcacagcgaccgcgtcgccatcctctacggcggcagcatgaacgccgccaatgccgcc
agcctgctggcccagccggacatcgacggcggcctgatcggcggggcctcgctcaaggcc
gcggatttcctgcagatcatcgccgccgcccgcgccgccaccgcctga

DBGET integrated database retrieval system