KEGG   Ramlibacter tataouinensis: Rta_26450Help
Entry
Rta_26450         CDS       T01544                                 

Definition
(GenBank) Triose-phosphate isomerase (Triosephosphate isomerase)-like protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00010  Glycolysis / Gluconeogenesis
rta00051  Fructose and mannose metabolism
rta00562  Inositol phosphate metabolism
rta01100  Metabolic pathways
rta01110  Biosynthesis of secondary metabolites
rta01120  Microbial metabolism in diverse environments
rta01130  Biosynthesis of antibiotics
rta01200  Carbon metabolism
rta01230  Biosynthesis of amino acids
Module
rta_M00002  Glycolysis, core module involving three-carbon compounds
rta_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rta_26450
   00051 Fructose and mannose metabolism
    Rta_26450
   00562 Inositol phosphate metabolism
    Rta_26450
Enzymes [BR:rta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rta_26450
Exosome [BR:rta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rta_26450
  Exosomal proteins of bladder cancer cells
   Rta_26450
  Exosomal proteins of melanoma cells
   Rta_26450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: AEG93746
UniProt: F5Y3T9
Position
complement(2814890..2815657)
Genome map
AA seq 255 aa AA seqDB search
MNMKKKKLIAGNWKMNGGIAANDALVRAVVAGMGADAGCQVAVCAPAPYLAQVQMLRHGS
ALELGAQDVSRHEQGAYTGEVSAAMLKEFGVRFAIVGHSERRQYHGESDALVADKAKAAL
AHGITPIVCVGETLAEREAGQTEAVVKRQLAAVIHANGHCISEIAVAYEPVWAIGTGRTA
TPGQAQQVHAVLRAQLQAATAHSDRVAILYGGSMNAANAASLLAQPDIDGGLIGGASLKA
ADFLQIIAAARAATA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatgaaaaagaaaaagctcatcgccggcaactggaagatgaacggcggcatcgcc
gccaacgacgcgctggtgcgcgccgtggtggcgggcatgggtgccgatgcgggctgccag
gtggcggtctgcgcgccggcgccctacctggcgcaggtgcagatgctgcgccacggctcg
gcgctcgagctcggcgcgcaggacgtctcgcgccacgagcagggcgcctacaccggcgag
gtgtcggccgccatgctcaaggagttcggcgtgcgtttcgccatcgtcgggcattccgag
cgccgccagtaccacggcgagagcgacgcgctggtggccgacaaggccaaggcggcgctc
gcgcacggcatcacgcccatcgtctgcgtcggcgagacgctggccgagcgcgaggccggc
cagaccgaggcggtggtcaagcgccagctggccgccgtgatccacgccaacgggcattgc
atcagcgagatcgcggtcgcctacgagccggtctgggccatcggcaccggccggaccgcc
acgcccgggcaggcccagcaggtgcatgccgtgctgcgcgcgcagctgcaggcggccacc
gcgcacagcgaccgcgtcgccatcctctacggcggcagcatgaacgccgccaatgccgcc
agcctgctggcccagccggacatcgacggcggcctgatcggcggggcctcgctcaaggcc
gcggatttcctgcagatcatcgccgccgcccgcgccgccaccgcctga

DBGET integrated database retrieval system