KEGG   Ramlibacter tataouinensis: Rta_27770Help
Entry
Rta_27770         CDS       T01544                                 

Gene name
folK
Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rta  Ramlibacter tataouinensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rta00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2958299..2958793)
Genome map
AA seq 164 aa AA seqDB search
MAAGGAGAVLREPVTAYVGLGANLGDAAGAVRQAIGQLGTLPQTALRAQSSLYRSAPVDA
GGPDFVNAVAVLDTRLPAPLLLLELQRLEQAAGRERPFRNAPRTLDLDLLLYGEGRIAST
SLTVPHPRLRERAFVLVPLAEIAPQLVPRPWLEAVTSQVIARLT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcggtgcgggcgctgtcctgcgcgagcccgtcaccgcctacgtcggcctg
ggcgccaatctgggcgatgcggccggcgcggtgcgccaggcgatcgggcagctggggaca
ctgccgcagacggcgttgcgcgcccagtcgtcgctctaccgcagcgcgccggtggatgcc
ggcggcccggacttcgtcaatgccgtggcggtcctggacacccgcctgcctgcgccgctg
ctgctgctggagctgcagcggctggagcaggcggccgggcgcgagcgcccgttccgcaac
gcgccgcgcacgctggacctggacctgctgctgtacggcgagggccgcatcgccagcacc
tccctcacggtgccgcacccgcgcctgcgcgagcgcgccttcgtgctggtgccgctggcc
gagatcgcgccgcagctggtgccgcggccctggctggaggccgtgacctcccaggtcatt
gcccgcctgacctga

DBGET integrated database retrieval system