KEGG   Ramlibacter tataouinensis: Rta_28090Help
Entry
Rta_28090         CDS       T01544                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rta  Ramlibacter tataouinensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rta_28090
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rta_28090
   00650 Butanoate metabolism
    Rta_28090
  Energy metabolism
   00190 Oxidative phosphorylation
    Rta_28090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2992760..2993125
Genome map
AA seq 121 aa AA seqDB search
MAVNYGSKRVVVGAHYGMRDWLSQRVTAVLMALFTVVVLAQLVFFRGPIGYDKWAGIFAP
QWMKVLTFATVIGLLYHVWVGMRDVLMDYIKPVGLRLALQIFVIVWLVGCVGWAVQVLWR
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgaattacggctccaagcgcgtcgtcgtcggcgcccactacggcatgcgcgac
tggctcagccagcgcgtgaccgcggtgctgatggccctcttcaccgtggtggtgctggcc
cagctggtcttcttccgcggccccatcggctacgacaagtgggcgggcatcttcgcgccg
cagtggatgaaggtgctgaccttcgccaccgtcatcggcctgctctaccacgtctgggtg
ggcatgcgcgacgtgctgatggactacatcaagccggtcggcctgcgcctggcgctgcag
atcttcgtcatcgtctggctggtcggctgcgtcggctgggccgtccaggtcctctggaga
atttga

DBGET integrated database retrieval system