KEGG   Ramlibacter tataouinensis: Rta_28220Help
Entry
Rta_28220         CDS       T01544                                 

Gene name
trpB
Definition
(GenBank) candidate tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rta_28220 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rta_28220 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rta_28220 (trpB)
Enzymes [BR:rta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rta_28220 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3007312..3008559
Genome map
AA seq 415 aa AA seqDB search
MTPYQQPDAAGHFGIYGGSFVSETLTHAINELRAAYARYQHDPEFLAEFRHELAHFVGRP
SPIYHASRMSQEMGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGIEDVKRQSPNVYRMNLLGAKVVPVESGSRTLKDALNEAMR
DWVTNVENTFYIIGTVAGPHPYPMMVRDFQSVIGNECLKQMPEMTGRQPDAVVACVGGGS
NAMGIFHPYIPHEKTRLIGVEAAGEGLDSGKHSASLQRGSPGVLHGNRTYILQDDNGQIT
ETHSVSAGLDYPGVGPEHAWLKDIGRAEYVGITDKEALEAFHYLCRTEGIIPALESSHAI
AYAMKLAGTLGRDQSILVNLSGRGDKDIGTVADLAGVDFYDRPSMRGLGVKGGGR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactccctaccagcaacctgacgccgccggccacttcggcatctatggcggcagcttc
gtcagcgagacgctgacccacgccatcaacgagctgcgcgccgcctacgcgcgctaccag
cacgatcccgagttcctggccgaattccggcacgagctggcgcacttcgtgggccgcccc
tcccccatctaccacgcctcgcgcatgagccaggagatgggcggcgcgcagatttacctc
aagcgcgaggacctcaaccacaccggcgcgcacaagatcaacaacgtgatcgggcaggcc
atgctggcgcggcgcatgggcaagccgcgggtgatcgccgagaccggcgccggccagcac
ggcgtggccaccgccaccatctgcgcgcgctacgggctggaatgcgtggtctacatgggg
attgaggacgtcaagcgccagagccccaacgtctaccgcatgaacctgctgggcgccaag
gtggtgccggtggaatccggcagcaggacgctgaaggacgccttgaacgaggccatgcgc
gactgggtgacgaacgtcgagaacaccttctacatcatcggcaccgtggccggcccgcat
ccctacccgatgatggtgcgcgacttccagagcgtgatcggcaacgagtgcctgaagcag
atgccggagatgaccggccggcagcccgacgcggtggtcgcctgcgtgggcggcggcagc
aacgccatgggcatcttccacccctacatcccgcacgagaagacacgcctgatcggcgtg
gaggccgctggcgagggcctggacagcggcaagcattcggcctcgctgcaacgaggcagc
ccgggcgtgctgcacggcaaccgcacctacatcctgcaggacgacaacggccagatcacc
gagacccacagcgtcagcgcgggcctggactatcccggcgtcgggcccgagcatgcctgg
ctcaaggacatcggccgcgccgaatacgtgggcatcaccgacaaggaagccctggaggcc
ttccactacctgtgccgcaccgagggcatcatcccggcgctggaatccagccacgccatc
gcctacgcgatgaagctggccgggacgctgggccgcgaccagagcatcctggtcaacctg
tccggccgcggcgacaaggacataggcaccgtcgccgacctggcgggcgtggacttctac
gatcgcccgtcgatgcgcggcctgggcgtcaagggcggcggccgatga

DBGET integrated database retrieval system