KEGG   Ramlibacter tataouinensis: Rta_28230Help
Entry
Rta_28230         CDS       T01544                                 

Gene name
trpA
Definition
(GenBank) candidate tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rta_28230 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rta_28230 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rta_28230 (trpA)
Enzymes [BR:rta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rta_28230 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3008556..3009365
Genome map
AA seq 269 aa AA seqDB search
MSRIAPTLAALKAGGRKALIPYVTAGFPEAEITPELMHAMAGAGADIIELGIPFSDPMAD
GPVIQRAGEKALALGVGLAQVLEMVRTFRRSDDRTPVVLMGYANPVERYDLRHGEGAFIR
DAAQAGVDGVLIVDYPPEECEGFAARLRSAGLDLIFLLAPTSTDERMRQVARLASGYVYY
VSLKGVTGAGHLDTAAVERMLPRIRAQVSVPVGVGFGIRDPETARAIARVADAVVIGTRL
IQVIEEQPRDQVLPAAAAFLGGIRRALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgcccccacgctggcggcgctgaaggccggcggccgcaaggccctcatc
ccctacgtcacggccggcttccccgaggcggagatcacccccgagctgatgcacgccatg
gccggcgctggcgcggacatcatcgagctgggcattccgttctccgaccccatggccgac
ggcccggtgatccagcgcgccggcgagaaggcgctggcgctgggcgtgggcctggcccag
gtcctggagatggtgcgcacgttccgccggagcgacgaccgcacgccggtcgtcctgatg
ggttacgccaacccggtggagcgctatgacctgcgccacggcgagggggccttcatccgc
gatgccgcccaggccggcgtggacggcgtgctcatcgtcgactacccgcccgaggagtgc
gagggcttcgccgcccgcctgcgctcggccggcctggacctgatcttcctgctggccccc
accagcacggacgaacgcatgcggcaggtcgcccggctggccagcggctatgtctactac
gtctcgctcaagggcgtgaccggcgcgggccacctggacaccgccgcggtggaacggatg
ctgccgcgcatccgggcgcaggtcagcgtgccggtgggcgtgggtttcggcatccgcgat
cccgagaccgcgcgcgccatcgcccgcgtggccgatgccgtggtgataggcacccggctg
atccaggtgatcgaggagcagccgcgcgaccaggtgctgccggcggccgccgcctttctc
ggtggtatccgccgggcgctggacgcataa

DBGET integrated database retrieval system