KEGG   Ramlibacter tataouinensis: Rta_28360Help
Entry
Rta_28360         CDS       T01544                                 

Definition
b-N-acetylhexosaminidase, Glycoside Hydrolase Family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rta  Ramlibacter tataouinensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rta_28360
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Rta_28360
Enzymes [BR:rta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rta_28360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3021750..3022832)
Genome map
AA seq 360 aa AA seqDB search
MTEHAPVILDVAGLQLTDADRRRLAHPLCGGMILFARNWQDREQLARLCAEVKAVREDLL
ICVDHEGGRVQRFRTDGFTRLPPMRAFGELWMRDGGKGASAMQATDAATAAGYVLAAELR
ACGVDFSFTPVLDLDWGGSGVIGDRAFHRDARVAALLAKSLAHGLLQAGMASCGKHFPGH
GFVKADSHVAIPVDQRSLKAILADDAAPYGWLSSSLSSVMPAHVIYPQVDARPAGFSSRW
LNGILRGQLGFQGAVFSDDLSMAGARVIEGRQVGYTEAAVTALNAGCDMVLLCNQSVETE
GGAAVDELLEGLAAAQEQRQWQSSEASEQRRLELLPARPALSWDALMAEPRYMRALDLLP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacatgcgcccgtcatcctggacgtggccgggctgcagctgaccgatgccgat
cgccgtcgcctggcccacccgctgtgcggtggcatgatcctgttcgcccgcaactggcag
gaccgcgagcagctggcccgtctgtgcgccgaggtcaaggccgtgcgcgaggacctgctg
atctgcgtggaccacgagggcggccgcgtccagcgcttccgcaccgacggcttcacccgc
ctgccgcccatgcgcgccttcggcgagctgtggatgcgcgacggcggcaagggcgcgagc
gcgatgcaggccaccgatgccgcaacggcggccggctacgtgctggccgccgagctgcgc
gcctgcggcgtggacttcagcttcacgccggtgctggacctcgactggggcggcagcggt
gtcatcggcgaccgcgccttccaccgcgatgcgcgggtggccgcgctgctggccaagagc
ctggcgcacgggctgttgcaggccggcatggccagctgcggcaagcacttccccggccat
ggcttcgtcaaggccgattcgcacgtagccattcccgtcgaccagcgcagcctgaaggcc
atcctggccgacgatgccgcgccctacggctggctgagcagttcgctgtccagtgtgatg
cccgcgcacgtgatctacccgcaggtggacgcgcggcctgcgggcttttccagccgctgg
ctgaacggcatcctgcgcggccagctgggcttccagggcgcggtcttcagcgatgacctg
agcatggccggcgcgcgggtgatcgagggccggcaggtgggctacaccgaagccgccgtc
acggcgctgaacgccggctgcgacatggtgctgctgtgcaaccagtcggtggaaacggag
ggcggcgccgccgtcgatgaattgctggaggggctggccgcggcgcaggagcagcgccag
tggcagtccagcgaggccagcgagcagcgccggctggagctgctgccggcgcgtccggcg
ttgtcctgggatgcattgatggccgagccgcgctatatgcgcgcgctcgatctgctgccc
tga

DBGET integrated database retrieval system