KEGG   Ramlibacter tataouinensis: Rta_28670Help
Entry
Rta_28670         CDS       T01544                                 

Definition
(GenBank) Hydroxymethylbilane hydrolyase (cyclizing)
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00860  Porphyrin and chlorophyll metabolism
rta01100  Metabolic pathways
rta01110  Biosynthesis of secondary metabolites
rta01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rta_28670
Enzymes [BR:rta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rta_28670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 MctB
Motif
Other DBs
NCBI-ProteinID: AEG93970
UniProt: F5Y5T6
Position
complement(3051433..3052200)
Genome map
AA seq 255 aa AA seqDB search
MSVIVTRPLREAARWVQALRDHGIAAEALPLIAIAPAPDAQAVARAWQSLPQCAAAMFVS
AQAAAGFFEAGAPAALQALRTRAWATGPGTRDALLAAGWPAARIDAPCDAAPQFDSEALW
SVVRGQLQPGDRVLIVRGGDAGGEPAGRDWLAQQLRQAGAEVAQVASYVRQRPVWSPVQC
SRAGAAAQDGSWWLFSSSQALGHLRTLVPDQDWSRARAVATHPRIAQAARAAGFGEVAQS
RPTLAALLAFLQSRG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtgatcgtgacgcgacccctgcgcgaggccgcgcgctgggtgcaggcattgcgg
gaccatggcatcgccgccgaggccttgccgctgatagccatcgcccccgcacccgacgcg
caggccgtggcgcgagcttggcagtcgctgccgcagtgcgcggccgccatgttcgtcagc
gcccaggccgcggcgggttttttcgaggccggcgctcccgcggcgctgcaagccctgcgg
acccgggcctgggccaccggccccggcacccgcgacgccttgctggcggccggctggccc
gcagcgcgcatcgatgcgccgtgcgacgccgcgccgcagttcgattccgaggcgctgtgg
agcgtggtgcgcgggcagctgcagcccggcgaccgggtgctgatcgtgcgcggtggcgac
gccggtggcgagccggccggccgcgactggctggcgcagcagctgcggcaggcgggcgcc
gaggtggcccaggtggccagctatgtgcgccagcggccggtctggagccctgtgcagtgc
tcgcgcgccggcgcggcggcgcaggacggcagctggtggctgttcagcagctcgcaggcc
ctgggccacctgcggacgcttgtgccggaccaggactggtcgcgcgcccgcgccgtggcc
acccacccgcgcatcgcgcaggcggcgcgcgcggccggattcggcgaggtggcgcaatcc
cgtccgacgcttgcggcgttgctcgccttcctacaatcgcgcggatga

DBGET integrated database retrieval system