KEGG   Ramlibacter tataouinensis: Rta_30770Help
Entry
Rta_30770         CDS       T01544                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rta  Ramlibacter tataouinensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rta_30770 (gpmA)
   01230 Biosynthesis of amino acids
    Rta_30770 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rta_30770 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Rta_30770 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rta_30770 (gpmA)
Enzymes [BR:rta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rta_30770 (gpmA)
Exosome [BR:rta04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rta_30770 (gpmA)
  Exosomal proteins of melanoma cells
   Rta_30770 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3283504..3284247
Genome map
AA seq 247 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWTDVDLTPTGIEQAKNAGRLLRSEGWDFDLAYTSVLKR
ATRTLWHCLDELDRTWLPVVHSWRLNERHYGALQGLNKAETAKKFGDEQVLLWRRSYDVP
PPALDPNDPRCERGDVRYAKLAPGQVPLTECLKDTVARVLPFWNESMAPAIKAGKRLVVA
AHGNSIRALVKYLDGISDGDIVGLNIPNGIPLVYELDAGLRPIRHYYLGDEAAARAAAAA
VASQGKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgtgctgatccgccacggcgaatcgacctggaacctggagaaccgcttc
accggctggaccgacgtggacctcacgcccaccgggatcgagcaggccaagaacgccggc
cggctgctgcgcagcgaaggctgggacttcgacctggcctacaccagcgtgctcaagcgc
gccacccgcaccttgtggcactgcctggacgagctggaccgcacctggctgccggtggtg
cattcctggcggctgaacgagcgccactacggcgcgctgcagggcctgaacaaggcggaa
acggccaagaagttcggcgacgagcaggtgctgctctggcgccgcagctacgacgtgccg
ccgccggctctggaccccaacgacccgcgctgcgagcgcggcgacgtgcgctacgccaag
ctggccccgggccaggtgccgctgaccgaatgcctgaaggacacggtggcccgggtgctg
ccgttctggaacgagtccatggccccggcgatcaaggccggcaagcgcctggtggtggcg
gcgcacggcaactcgatccgcgccctggtcaagtacctcgatggcatctccgacggcgac
atcgtgggcctgaacatccccaacggcatcccgctggtctacgagctggatgccggcctg
aggccgatccgccactactacctgggcgacgaggcggccgcccgggccgcggcggccgcc
gtggccagccagggcaagggctga

DBGET integrated database retrieval system